Tested Applications
Positive WB detected in | Raji cells, HEK-293T cells |
Positive IHC detected in | human ovary cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:6000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
IHC | See 1 publications below |
Product Information
26793-1-AP targets SIPA1 in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25383 Product name: Recombinant human SIPA1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 950-1042 aa of BC010492 Sequence: GQPIPESGDPKGTPKSDAEPEPGNLSEKVSHLESMLRKLQEDLQKEKADRAALEEEVRSLRHNNRRLQAESESAATRLLLASKQLGSPTADLA Predict reactive species |
Full Name | signal-induced proliferation-associated 1 |
Calculated Molecular Weight | 1042 aa, 112 kDa |
Observed Molecular Weight | 130 kDa |
GenBank Accession Number | BC010492 |
Gene Symbol | SIPA1 |
Gene ID (NCBI) | 6494 |
RRID | AB_2880637 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q96FS4 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SIPA1 (Signal-induced proliferation-associated protein 1) is also named as SPA1, p130 SPA-1 and GTPase-activating protein Spa-1. SIPA1, a GTPase activating protein, was discovered in proliferating lymphocytes as mitogen-induced nuclear protein. SIPA1 promotes catalyzation of hydrolyze Rap1GTP/GDP and is known to be a negative regulator of Ras-related protein, which transduces the signals for various cellular functions, including development, cellular proliferation, and cellular adhesion (PMID:28237246). Transcription of fibronectin 1, which is crucial for cell junction and migration of triple-negative breast cancer (TNBC) cells, was regulated by SIPA1 in a DBR-dependent manner. SIPA1 was highly expressed in metastatic TNBC. SIPA1 served as a TF, promoting TNBC migration, invasion, and metastasis (PMID: 37500797).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for SIPA1 antibody 26793-1-AP | Download protocol |
IHC protocol for SIPA1 antibody 26793-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |