Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, MDA-MB-231 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human colon cancer tissue, human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells, HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
13161-1-AP targets SIRT1 in WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, pig, chicken, zebrafish, bovine, sheep, goat, duck |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3808 Product name: Recombinant human SIRT1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC012499 Sequence: MIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGALFSQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRTQKELAYLSELPPTPLHVSEDSSSPE Predict reactive species |
| Full Name | sirtuin (silent mating type information regulation 2 homolog) 1 (S. cerevisiae) |
| Calculated Molecular Weight | 747 aa, 82 kDa |
| Observed Molecular Weight | 110-130 kDa, 80-85 kDa |
| GenBank Accession Number | BC012499 |
| Gene Symbol | SIRT1 |
| Gene ID (NCBI) | 23411 |
| RRID | AB_10646436 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96EB6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SIRT1, also named SIR2L1, contains a deacetylase sirtuin-type domain and belongs to the sirtuin family. The post-translation modified SIRT1 is a 110-130 kDa protein, which contains one deacetylase sirtuin-type domain. The 75-80 kDa SirT1 fragment was detected to lack the carboxy-terminus (PMID:21305533). SirT1 exists a 57-61 kDa isoform. SIRT1 may be found in nucleolus, nuclear euchromatin, heterochromatin, and inner membrane. It can shuttle between the nucleus and cytoplasm. SIRT1 regulates processes such as apoptosis and muscle differentiation by deacetylating key proteins. SIRT1 in particular initiates several signaling events relevant to cardioprotection, including activation of endothelial nitric oxide synthase, INS receptor signaling, and autophagy. In addition, SIRT1 activation elicits resistance to oxidative stress via the regulation of transcription factors and co-activators such as FOXO, Hif-2a, and NF-kB. SIRT1 regulates the p53-dependent DNA damage response pathway by binding to and deacetylating p53, specifically at Lysine 382. This antibody is a rabbit polyclonal antibody raised against residues near the N terminus of human SIRT1.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SIRT1 antibody 13161-1-AP | Download protocol |
| IHC protocol for SIRT1 antibody 13161-1-AP | Download protocol |
| IP protocol for SIRT1 antibody 13161-1-AP | Download protocol |
| WB protocol for SIRT1 antibody 13161-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Metab IgG is an aging factor that drives adipose tissue fibrosis and metabolic decline | ||
Cell Metab Elevation of JAML Promotes Diabetic Kidney Disease by Modulating Podocyte Lipid Metabolism.
| ||
Bioact Mater Silicate ions as soluble form of bioactive ceramics alleviate aortic aneurysm and dissection | ||
Nat Commun Phosphoglycerate dehydrogenase activates PKM2 to phosphorylate histone H3T11 and attenuate cellular senescence | ||
J Pineal Res Melatonin enhances mitochondrial biogenesis and protects against rotenone-induced mitochondrial deficiency in early porcine embryos. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Iram (Verified Customer) (12-19-2025) | Good antibody for WB
|
FH MALLIKARJUNA (Verified Customer) (11-26-2025) | good for wb
|
FH Tatyana (Verified Customer) (06-15-2025) | Incubation ON at 4C, in 5% goat serum in PBST. Gives primarily nuclear signal.
![]() |
FH Uxoa (Verified Customer) (02-19-2020) | Non nuclear signal of SIRT1 in human fibroblast. Cells fixed with 4% PFA 15 min. Ab dilution 1:100 in PBST (0.1% triton)+10% GS. O/N 4ºC incubation. Secondary ab: Goat anti-rabbit alexafluor 555 1:500 in PBST + 10% GS 1h RT.
![]() |
FH Tanusree (Verified Customer) (12-18-2019) | Product worked well in WB at 1:500 dilution
|























