• Featured Product
  • KD/KO Validated

CoraLite® Plus 750-conjugated SIRT1 Polyclonal antibody

SIRT1 Polyclonal Antibody for WB, FC (Intra)
Cat No. CL750-13161

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra)

EC:2.3.1.-, EC:2.3.1.286, hSIR2, hSIRT1, NAD-dependent protein deacetylase sirtuin-1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 750
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, MDA-MB-231 cells
Positive FC (Intra) detected inA431 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL750-13161 targets SIRT1 in WB, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3808

Product name: Recombinant human SIRT1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-350 aa of BC012499

Sequence: MIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGALFSQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRTQKELAYLSELPPTPLHVSEDSSSPE

Predict reactive species
Full Name sirtuin (silent mating type information regulation 2 homolog) 1 (S. cerevisiae)
Calculated Molecular Weight 747 aa, 82 kDa
Observed Molecular Weight 110-130 kDa, 80-85 kDa
GenBank Accession NumberBC012499
Gene Symbol SIRT1
Gene ID (NCBI) 23411
RRIDAB_3084833
Conjugate CoraLite® Plus 750 Fluorescent Dye
Excitation/Emission Maxima Wavelengths755 nm / 780 nm
Excitation LaserRed Laser (633 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ96EB6
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

SIRT1, also named as SIR2L1, contains a deacetylase sirtuin-type domain and belongs to the sirtuin family. The post-translation modified SIRT1 is a 110-130 kDa protein, which contains one deacetylase sirtuin-type domain. The 75-80 kDa SirT1 fragment was detected to lack the carboxy-terminus (PMID:21305533). SirT1 exists a 57-61 kDa isoform. SIRT1 may be found in nucleolus, nuclear euchromatin, heterochromatin, and inner membrane. It can shuttle between the nucleus and cytoplasm. SIRT1 regulates processes such as apoptosis and muscle differentiation by deacetylating key proteins. SIRT1 in particular initiates several signaling events relevant to cardioprotection, including activation of endothelial nitric oxide synthase, INS receptor signaling, and autophagy. In addition, SIRT1 activation elicits resistance to oxidative stress via the regulation of transcription factors and co-activators such as FOXO, Hif-2a, and NF-kB. SIRT1 regulates the p53-dependent DNA damage response pathway by binding to and deacetylating p53, specifically at Lysine 382. This antibody is a rabbit polyclonal antibody raised against residues near the N terminus of human SIRT1.

Protocols

Product Specific Protocols
FC protocol for CL Plus 750 SIRT1 antibody CL750-13161Download protocol
WB protocol for CL Plus 750 SIRT1 antibody CL750-13161Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...