• Featured Product
  • KD/KO Validated

SIRT1 Polyclonal antibody

SIRT1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 13161-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (7)

Applications

WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA

EC:2.3.1.-, EC:2.3.1.286, hSIR2, hSIRT1, NAD-dependent protein deacetylase sirtuin-1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 750
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, HeLa cells, MDA-MB-231 cells
Positive IP detected inHeLa cells
Positive IHC detected inhuman colon cancer tissue, human lung cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells, HeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13161-1-AP targets SIRT1 in WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, pig, chicken, zebrafish, bovine, sheep, goat, duck
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3808

Product name: Recombinant human SIRT1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-350 aa of BC012499

Sequence: MIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGALFSQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRTQKELAYLSELPPTPLHVSEDSSSPE

Predict reactive species
Full Name sirtuin (silent mating type information regulation 2 homolog) 1 (S. cerevisiae)
Calculated Molecular Weight 747 aa, 82 kDa
Observed Molecular Weight 110-130 kDa, 80-85 kDa
GenBank Accession NumberBC012499
Gene Symbol SIRT1
Gene ID (NCBI) 23411
RRIDAB_10646436
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ96EB6
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SIRT1, also named SIR2L1, contains a deacetylase sirtuin-type domain and belongs to the sirtuin family. The post-translation modified SIRT1 is a 110-130 kDa protein, which contains one deacetylase sirtuin-type domain. The 75-80 kDa SirT1 fragment was detected to lack the carboxy-terminus (PMID:21305533). SirT1 exists a 57-61 kDa isoform. SIRT1 may be found in nucleolus, nuclear euchromatin, heterochromatin, and inner membrane. It can shuttle between the nucleus and cytoplasm. SIRT1 regulates processes such as apoptosis and muscle differentiation by deacetylating key proteins. SIRT1 in particular initiates several signaling events relevant to cardioprotection, including activation of endothelial nitric oxide synthase, INS receptor signaling, and autophagy. In addition, SIRT1 activation elicits resistance to oxidative stress via the regulation of transcription factors and co-activators such as FOXO, Hif-2a, and NF-kB. SIRT1 regulates the p53-dependent DNA damage response pathway by binding to and deacetylating p53, specifically at Lysine 382. This antibody is a rabbit polyclonal antibody raised against residues near the N terminus of human SIRT1.

Protocols

Product Specific Protocols
IF protocol for SIRT1 antibody 13161-1-APDownload protocol
IHC protocol for SIRT1 antibody 13161-1-APDownload protocol
IP protocol for SIRT1 antibody 13161-1-APDownload protocol
WB protocol for SIRT1 antibody 13161-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
WB

Nature

A plant-derived natural photosynthetic system for improving cell anabolism

Authors - Pengfei Chen
WB

Cell Metab

IgG is an aging factor that drives adipose tissue fibrosis and metabolic decline

Authors - Lexiang Yu
WB,IF

Cell Metab

Elevation of JAML Promotes Diabetic Kidney Disease by Modulating Podocyte Lipid Metabolism.

Authors - Yi Fu
  • KD Validated
WB

Bioact Mater

Silicate ions as soluble form of bioactive ceramics alleviate aortic aneurysm and dissection

Authors - Yumei Que
WB,IHC

Nat Commun

Phosphoglycerate dehydrogenase activates PKM2 to phosphorylate histone H3T11 and attenuate cellular senescence

Authors - Yinsheng Wu
IF

J Pineal Res

Melatonin enhances mitochondrial biogenesis and protects against rotenone-induced mitochondrial deficiency in early porcine embryos.

Authors - Ying-Jie Niu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Sai Sindhura (Verified Customer) (03-23-2026)

Very good antibody

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
FH

Sai Sindhura (Verified Customer) (01-08-2026)

SIRT1 is working very nice

  • Applications: Western Blot, Immunohistochemistry
  • Primary Antibody Dilution: 1:3000
FH

Iram (Verified Customer) (12-19-2025)

Good antibody for WB

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000 for IB
  • Cell Tissue Type: CRC cells
FH

MALLIKARJUNA (Verified Customer) (11-26-2025)

good for wb

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
FH

Tatyana (Verified Customer) (06-15-2025)

Incubation ON at 4C, in 5% goat serum in PBST. Gives primarily nuclear signal.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HeLa/human
SIRT1 Antibody Immunofluorescence validation (1:1000 dilution) in HeLa/human (Cat no:13161-1-AP)
FH

Uxoa (Verified Customer) (02-19-2020)

Non nuclear signal of SIRT1 in human fibroblast. Cells fixed with 4% PFA 15 min. Ab dilution 1:100 in PBST (0.1% triton)+10% GS. O/N 4ºC incubation. Secondary ab: Goat anti-rabbit alexafluor 555 1:500 in PBST + 10% GS 1h RT.

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Human fibroblasts
SIRT1 Antibody Immunofluorescence, validation (1:100 dilution) in Human fibroblasts (Cat no:13161-1-AP)
FH

Tanusree (Verified Customer) (12-18-2019)

Product worked well in WB at 1:500 dilution

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Mouse brain
Loading...
||
New chat

Able

正在加载,请稍候...