SLC14A2 Polyclonal antibody

• 

  WB analysis using 21932-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21932-1-AP (SLC14A2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 21932-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21932-1-AP (SLC14A2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

SLC14A2 Polyclonal Antibody for WB, ELISA

Cat No. 21932-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

hUT A6, HUT2, SLC14A2, Urea transporter 2, Urea transporter, kidney, UT A2, UT2, UTA, UTR

---

Tested Applications

• Positive WB detected in: mouse brain tissue, human brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21932-1-AP targets SLC14A2 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16561

  Product name: Recombinant human SLC14A2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 431-610 aa of BC110445

  Sequence: EANRIYYLTVKSGEEEKAPSGGGGEHPPTAGPKVEEGSEAVLSKHRSVFHIEWSSIRRRSKVFGKGEHQERQNKDPFPYRYRKPTVELLDLDTMEESSEIKVETNISKTSWIRSSMAASGKRVSKALSYITGEMKECGEGLKDKSPVFQFFDWVLRGTSQVMFVNNPLSGILIILGLFIQ

• Full Name: solute carrier family 14 (urea transporter), member 2
• Calculated Molecular Weight: 920 aa, 101 kDa
• Observed Molecular Weight: 43 kDa, 101 kDa
• GenBank Accession Number: BC110445
• Gene Symbol: SLC14A2
• Gene ID (NCBI): 8170
• RRID: AB_3085679
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15849
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC14A2, also known as human urea transporter -2 (HUT2), is the human homolog of UT-A2 and the only kidney-specific urea transporter cloned in humans. Urea transport in the kidney is mediated by a family of transporter proteins, including renal urea transporters (UT-A) and erythrocyte urea transporters (UT-B). UT-A proteins expressed in the kidney play a critical role in generating the hypertonic medulla, which is an integral component of the urinary concentrating mechanism (PMID: 11590132, 11880324). The 4.2-kb hUT-A1 cDNA encodes a 920-amino acid peptide, which is 89% identical to the rat UT-A1 protein (PMID: 11502588).