SLC16A11 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83239-5-RR (same clone as 83239-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83239-5-RR (SLC16A11 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83239-5-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 83239-5-RR (same clone as 83239-5-PBS)

  WB result of SLC16A11 antibody (83239-5-RR; 1:12000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SLC16A11 transfected A549 cells. This data was developed using the same antibody clone with 83239-5-PBS in a different storage buffer formulation.

• 

  FC experiment of A549 using 83239-5-RR (same clone as 83239-5-PBS)

  1x10^6 A549 cells were intracellularly stained with 0.25 ug SLC16A11 Recombinant antibody (83239-5-RR, Clone:240081H5) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 83239-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83239-5-RR

  Biolayer interferometry (BLl) kinetic assays of 83239-5-RR against Human SLC16A11 were performed. The affinity constant is below 1 pM.

• Featured Product
• KD/KO Validated

SLC16A11 Uni-rAb^® Recombinant Antibody for WB, FC (Intra), Indirect ELISA

Cat No. 83239-5-PBS

Clone No.240081H5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, FC (Intra), Indirect ELISA

Synonyms

240081H5, FLJ90193, MCT 11, MCT11, Monocarboxylate transporter 11

---

Product Information

83239-5-PBS targets SLC16A11 in WB, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag24920

  Product name: Recombinant human SLC16A11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 397-471 aa of BC093860

  Sequence: FLRDETGDFTASFLLSGSLILSGSFIYIGLPRALPSCGPASPPATPPPETGELLPAPQAVLLSPGGPGSTLDTTC

• Full Name: solute carrier family 16, member 11 (monocarboxylic acid transporter 11)
• Calculated Molecular Weight: 471 aa, 48 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC093860
• Gene Symbol: SLC16A11
• Gene ID (NCBI): 162515
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q8NCK7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.