SLC16A11 Recombinant monoclonal antibody

• 

  WB analysis using 83239-5-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 83239-5-RR (SLC16A11 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A549 using 83239-5-RR

  WB result of SLC16A11 antibody (83239-5-RR; 1:12000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SLC16A11 transfected A549 cells.

• 

  FC experiment of A549 using 83239-5-RR

  1x10^6 A549 cells were intracellularly stained with 0.25 ug SLC16A11 Recombinant antibody (83239-5-RR, Clone:240081H5) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• 

  Affinity and Kinetic Characterization of 83239-5-RR

  Biolayer interferometry (BLl) kinetic assays of 83239-5-RR against Human SLC16A11 were performed. The affinity constant is below 1 pM.

• Featured Product
• KD/KO Validated

SLC16A11 Uni-rAb^® Recombinant Antibody for WB, FC (Intra), ELISA

Cat No. 83239-5-RR

Clone No.240081H5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, FC (Intra), ELISA

Synonyms

240081H5, FLJ90193, MCT 11, MCT11, Monocarboxylate transporter 11

---

Tested Applications

• Positive WB detected in: A549 cells, HeLa cells, mouse brain tissue, mouse stomach tissue
• Positive FC (Intra) detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83239-5-RR targets SLC16A11 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag24920

  Product name: Recombinant human SLC16A11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 397-471 aa of BC093860

  Sequence: FLRDETGDFTASFLLSGSLILSGSFIYIGLPRALPSCGPASPPATPPPETGELLPAPQAVLLSPGGPGSTLDTTC

• Full Name: solute carrier family 16, member 11 (monocarboxylic acid transporter 11)
• Calculated Molecular Weight: 471 aa, 48 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC093860
• Gene Symbol: SLC16A11
• Gene ID (NCBI): 162515
• RRID: AB_3670915
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q8NCK7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.