Tested Applications
Positive WB detected in | A549 cells, HeLa cells, mouse brain tissue, mouse stomach tissue |
Positive FC (Intra) detected in | A549 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:16000 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
83239-5-RR targets SLC16A11 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag24920 Product name: Recombinant human SLC16A11 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 397-471 aa of BC093860 Sequence: FLRDETGDFTASFLLSGSLILSGSFIYIGLPRALPSCGPASPPATPPPETGELLPAPQAVLLSPGGPGSTLDTTC Predict reactive species |
Full Name | solute carrier family 16, member 11 (monocarboxylic acid transporter 11) |
Calculated Molecular Weight | 471 aa, 48 kDa |
Observed Molecular Weight | 48 kDa |
GenBank Accession Number | BC093860 |
Gene Symbol | SLC16A11 |
Gene ID (NCBI) | 162515 |
RRID | AB_3670915 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purfication |
UNIPROT ID | Q8NCK7 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for SLC16A11 antibody 83239-5-RR | Download protocol |
FC protocol for SLC16A11 antibody 83239-5-RR | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |