SLC16A5 Polyclonal antibody

• 

  WB analysis of mouse skeletal muscle using 12120-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 12120-1-AP (SLC16A5 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human placenta using 12120-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 12120-1-AP (SLC16A5 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 12120-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 12120-1-AP (SLC16A5 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 12120-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 12120-1-AP (SLC16A5 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 12120-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 12120-1-AP (SLC16A5 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

SLC16A5 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 12120-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

MCT 5, MCT 6, MCT5, MCT6, Monocarboxylate transporter 5, Monocarboxylate transporter 6, SLC16A5

---

Tested Applications

• Positive WB detected in: mouse skeletal muscle tissue, human placenta tissue
• Positive IHC detected in: human breast cancer tissue, human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12120-1-AP targets SLC16A5 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2762

  Product name: Recombinant human SLC16A5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 418-505 aa of BC009684

  Sequence: ALQKKEQGKQAVAADALERDLFLEAKDGPGKQRSPEIMCQSSRQPRPAGVNKHLWGCPASSRTSHEWLLWPKAVLQAKQTALGWNSPT

• Full Name: solute carrier family 16, member 5 (monocarboxylic acid transporter 6)
• Calculated Molecular Weight: 505 aa, 55 kDa
• Observed Molecular Weight: 50-55 kDa
• GenBank Accession Number: BC009684
• Gene Symbol: SLC16A5
• Gene ID (NCBI): 9121
• RRID: AB_2877827
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15375
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Monocarboxylate transporter 5 (SLC16A5), also named as MCT6, is a member of the MCT family. SLC16A5 is a proton-linked monocarboxylate transporter that catalyzes the rapid transport across the plasma membrane of many monocarboxylates and it can transport various drugs. It has been reported that SLC16A5 mutation may be a novel genetic risk factor for cisplatin-induced ototoxic (CIO) in testicular cancer patients. There are some isoforms of SLC16A5 among 50-55 kDa. (PMID: 16174808, 28448657)