Product Information
84083-2-PBS targets VGLUT2 as part of a matched antibody pair:
MP00998-1: 84083-1-PBS capture and 84083-2-PBS detection (validated in Cytometric bead array)
Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag29565 Product name: Recombinant human SLC17A6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 499-582 aa of NM_020346 Sequence: SGEKQPWADPEETSEEKCGFIHEDELDEETGDITQNYINYGTTKSYGATTQANGGWPSGWEKKEEFVQGEVQDSHSYKDRVDYS Predict reactive species |
| Full Name | solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6 |
| Calculated Molecular Weight | 64 kDa |
| Observed Molecular Weight | 60 kDa |
| GenBank Accession Number | NM_020346 |
| Gene Symbol | VGLUT2 |
| Gene ID (NCBI) | 57084 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9P2U8 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
VGLUT2, also known as SLC17A6, belongs to the major facilitator superfamily. VGLUT2 is a multifunctional transporter that transports phosphate at the plasma membrane and glutamate in synaptic vesicles (PMID:33440152, 11432869). VGLUT2 is involved in neurotransmitter loading into synaptic vesicles (PMID: 11698620). VGLUT2 is predominantly expressed in adult and fetal brain, with highest expression in the medulla, substantia nigra, subthalamic nucleus, and thalamus, and low levels in the cerebellum and hippocampus (PMID:10820226).















