VGLUT2 Recombinant monoclonal antibody, PBS Only (Detector)

VGLUT2 Uni-rAb® Recombinant Antibody for WB, IHC, IF-Fro, Cytometric bead array, Indirect ELISA
Cat No. 84083-2-PBS
Clone No.241255B5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-Fro, Cytometric bead array, Indirect ELISA

SLC17A6, 241255B5, Differentiation-associated BNPI, Differentiation-associated Na(+)-dependent inorganic phosphate cotransporter, DNPI

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84083-2-PBS targets VGLUT2 as part of a matched antibody pair:

MP00998-1: 84083-1-PBS capture and 84083-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag29565

Product name: Recombinant human SLC17A6 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 499-582 aa of NM_020346

Sequence: SGEKQPWADPEETSEEKCGFIHEDELDEETGDITQNYINYGTTKSYGATTQANGGWPSGWEKKEEFVQGEVQDSHSYKDRVDYS

Predict reactive species
Full Name solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6
Calculated Molecular Weight 64 kDa
Observed Molecular Weight60 kDa
GenBank Accession NumberNM_020346
Gene Symbol VGLUT2
Gene ID (NCBI) 57084
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9P2U8
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

VGLUT2, also known as SLC17A6, belongs to the major facilitator superfamily. VGLUT2 is a multifunctional transporter that transports phosphate at the plasma membrane and glutamate in synaptic vesicles (PMID:33440152, 11432869). VGLUT2 is involved in neurotransmitter loading into synaptic vesicles (PMID: 11698620). VGLUT2 is predominantly expressed in adult and fetal brain, with highest expression in the medulla, substantia nigra, subthalamic nucleus, and thalamus, and low levels in the cerebellum and hippocampus (PMID:10820226).

Loading...
||
New chat Able
正在加载,请稍候...