Tested Applications
| Positive WB detected in | rat brain tissue, C2C12 cells, fetal human brain tissue, mouse brain tissue, Caco-2 cells, THP-1 cells |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | human skin tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human pancreas tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 2 publications below |
| IHC | See 3 publications below |
| IF | See 1 publications below |
Product Information
26731-1-AP targets SLC17A9 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24970 Product name: Recombinant human SLC17A9 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-85 aa of BC025312 Sequence: MTLTSRRQDSQEARPECQAWTGTLLLGTCLLYCARSSMPICTVSMSQDFGWNKKEAGIVLSSFFWGYCLTQVVGGHLGDRIGGEK Predict reactive species |
| Full Name | solute carrier family 17, member 9 |
| Calculated Molecular Weight | 436 aa, 47 kDa |
| Observed Molecular Weight | 68-70 kDa |
| GenBank Accession Number | BC025312 |
| Gene Symbol | SLC17A9 |
| Gene ID (NCBI) | 63910 |
| RRID | AB_2880617 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9BYT1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SLC17A9 antibody 26731-1-AP | Download protocol |
| IHC protocol for SLC17A9 antibody 26731-1-AP | Download protocol |
| IP protocol for SLC17A9 antibody 26731-1-AP | Download protocol |
| WB protocol for SLC17A9 antibody 26731-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
iScience SLC17A9-PTHLH-EMT axis promotes proliferation and invasion of clear renal cell carcinoma
| ||
bioRxiv Optimization of protocols for immunohistochemical assessment of enteric nervous system in formalin fixed human tissue | ||
Oncol Lett SLC17A9 expression levels in a pan‑cancer panel and validation of the role of SLC17A9 as a novel prognostic biomarker for osteosarcoma
|















