Tested Applications
| Positive WB detected in | rat brain tissue, C2C12 cells, fetal human brain tissue, mouse brain tissue, Caco-2 cells, THP-1 cells |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | human skin tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human pancreas tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26731-1-AP targets SLC17A9 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24970 Product name: Recombinant human SLC17A9 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-85 aa of BC025312 Sequence: MTLTSRRQDSQEARPECQAWTGTLLLGTCLLYCARSSMPICTVSMSQDFGWNKKEAGIVLSSFFWGYCLTQVVGGHLGDRIGGEK Predict reactive species |
| Full Name | solute carrier family 17, member 9 |
| Calculated Molecular Weight | 436 aa, 47 kDa |
| Observed Molecular Weight | 68-70 kDa |
| GenBank Accession Number | BC025312 |
| Gene Symbol | SLC17A9 |
| Gene ID (NCBI) | 63910 |
| RRID | AB_2880617 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9BYT1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SLC17A9 antibody 26731-1-AP | Download protocol |
| IHC protocol for SLC17A9 antibody 26731-1-AP | Download protocol |
| IP protocol for SLC17A9 antibody 26731-1-AP | Download protocol |
| WB protocol for SLC17A9 antibody 26731-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-SLC17A9 (VNUT) antibody (Cat# 26731-1-AP) has 5 total citations published in Biochim Biophys Acta Mol Basis Dis, iScience (×2), Oncol Lett, and bioRxiv. Research fields span liver fibrosis, metformin regulation of hyperglycemia, renal cell carcinoma, osteosarcoma prognosis, and enteric nervous system assessment. Applications include WB, IHC, and IF in human and mouse samples.
| Species | Application | Title |
|---|---|---|
Biochim Biophys Acta Mol Basis Dis Vesicular nucleotide transporter (VNUT)-dependent ATP secretion by hepatic stellate cells promotes liver fibrosis. | ||
iScience SLC17A9-PTHLH-EMT axis promotes proliferation and invasion of clear renal cell carcinoma
| ||
Oncol Lett SLC17A9 expression levels in a pan‑cancer panel and validation of the role of SLC17A9 as a novel prognostic biomarker for osteosarcoma
| ||
bioRxiv Optimization of protocols for immunohistochemical assessment of enteric nervous system in formalin fixed human tissue |
