Tested Applications
Positive WB detected in | SMMC-7721 cells |
Positive IHC detected in | human liver tissue, human liver cancer tissue, mouse liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:3000 |
Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
67479-1-Ig targets SLC22A7 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples.
Tested Reactivity | Human, mouse, rat |
Host / Isotype | Mouse / IgG2a |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25234 Product name: Recombinant human SLC22A7 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 42-140 aa of BC033805 Sequence: AAVPAHRCALPGAPANFSHQDVWLEAHLPREPDGTLSSCLRFAYPQALPNTTLGEERQSRGELEDEPATVPCSQGWEYDHSEFSSTIATESQWDLVCEQ Predict reactive species |
Full Name | solute carrier family 22 (organic anion transporter), member 7 |
Calculated Molecular Weight | 60 kDa |
Observed Molecular Weight | 60 kDa |
GenBank Accession Number | BC033805 |
Gene Symbol | SLC22A7 |
Gene ID (NCBI) | 10864 |
RRID | AB_2882706 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q9Y694 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Organic anion transporter (OAT)2 (SLC22A7) belongs to the solute carrier group of membrane transport proteins that mediate cellular uptake of numerous organic ions including xenobiotics and endogenous substrates (PMID: 9529348, 20190416). SLC22A7 was originally identified as a novel liver-specific transporter because of its predominant mRNA expression in the rat liver (PMID: 15900017, 25904762). Human SLC22A7 exhibits a robust transport function for a wide array of naturally occurring nucleobases, nucleosides, and nucleotides with a particular role for cGMP (PMID: 18216183).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for SLC22A7 antibody 67479-1-Ig | Download protocol |
IHC protocol for SLC22A7 antibody 67479-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |