SLC22A7 Monoclonal antibody, PBS Only

• 

  WB analysis of SMMC-7721 using 67479-1-Ig (same clone as 67479-1-PBS)

  SMMC-7721 cells were subjected to SDS PAGE followed by western blot with 67479-1-Ig (SLC22A7 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67479-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67479-1-Ig (same clone as 67479-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67479-1-Ig (SLC22A7 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67479-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67479-1-Ig (same clone as 67479-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67479-1-Ig (SLC22A7 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67479-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 67479-1-Ig (same clone as 67479-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 67479-1-Ig (SLC22A7 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67479-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 67479-1-Ig (same clone as 67479-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 67479-1-Ig (SLC22A7 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67479-1-PBS in a different storage buffer formulation.

SLC22A7 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 67479-1-PBS

Clone No.3D3C3

Host / Isotype

Mouse / IgG2a

Reactivity

Human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

SLC22A7, 3D3C3, hOAT2, NLT, OAT2

---

Product Information

67479-1-PBS targets SLC22A7 in WB, IHC, Indirect ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25234

  Product name: Recombinant human SLC22A7 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 42-140 aa of BC033805

  Sequence: AAVPAHRCALPGAPANFSHQDVWLEAHLPREPDGTLSSCLRFAYPQALPNTTLGEERQSRGELEDEPATVPCSQGWEYDHSEFSSTIATESQWDLVCEQ

• Full Name: solute carrier family 22 (organic anion transporter), member 7
• Calculated Molecular Weight: 60 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC033805
• Gene Symbol: SLC22A7
• Gene ID (NCBI): 10864
• RRID: AB_2882706
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9Y694
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Organic anion transporter (OAT)2 (SLC22A7) belongs to the solute carrier group of membrane transport proteins that mediate cellular uptake of numerous organic ions including xenobiotics and endogenous substrates (PMID: 9529348, 20190416). SLC22A7 was originally identified as a novel liver-specific transporter because of its predominant mRNA expression in the rat liver (PMID: 15900017, 25904762). Human SLC22A7 exhibits a robust transport function for a wide array of naturally occurring nucleobases, nucleosides, and nucleotides with a particular role for cGMP (PMID: 18216183).