Filter: AllWBIHC

WB analysis using 67635-1-Ig (same clone as 67635-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 67635-1-Ig (SLC25A17 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Beta Actin Monoclonal antibody (HRP-66009) as loading control. This data was developed using the same antibody clone with 67635-1-PBS in a different storage buffer formulation.
×
Various lysates were subjected to SDS PAGE followed by western blot with 67635-1-Ig (SLC25A17 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Beta Actin Monoclonal antibody (HRP-66009) as loading control. This data was developed using the same antibody clone with 67635-1-PBS in a different storage buffer formulation.
WB analysis of U2OS using 67635-1-Ig (same clone as 67635-1-PBS)
U2OS cells were subjected to SDS PAGE followed by western blot with 67635-1-Ig (SLC25A17 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67635-1-PBS in a different storage buffer formulation.
WB analysis of A549 using 67635-1-Ig (same clone as 67635-1-PBS)
A549 cells were subjected to SDS PAGE followed by western blot with 67635-1-Ig (SLC25A17 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67635-1-PBS in a different storage buffer formulation.
IHC staining of human liver cancer using 67635-1-Ig (same clone as 67635-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67635-1-Ig (SLC25A17 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67635-1-PBS in a different storage buffer formulation.
IHC staining of human liver cancer using 67635-1-Ig (same clone as 67635-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67635-1-Ig (SLC25A17 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67635-1-PBS in a different storage buffer formulation.
IHC staining of human liver cancer using 67635-1-Ig (same clone as 67635-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67635-1-Ig (SLC25A17 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67635-1-PBS in a different storage buffer formulation.
IHC staining of human liver cancer using 67635-1-Ig (same clone as 67635-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67635-1-Ig (SLC25A17 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67635-1-PBS in a different storage buffer formulation.
IHC staining of human liver using 67635-1-Ig (same clone as 67635-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 67635-1-Ig (SLC25A17 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67635-1-PBS in a different storage buffer formulation.
IHC staining of human liver using 67635-1-Ig (same clone as 67635-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 67635-1-Ig (SLC25A17 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67635-1-PBS in a different storage buffer formulation.
IHC staining of mouse liver using 67635-1-Ig (same clone as 67635-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 67635-1-Ig (SLC25A17 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67635-1-PBS in a different storage buffer formulation.
IHC staining of mouse liver using 67635-1-Ig (same clone as 67635-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 67635-1-Ig (SLC25A17 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67635-1-PBS in a different storage buffer formulation.

SLC25A17 Monoclonal antibody, PBS Only

SLC25A17 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 67635-1-PBS

Clone No.2D1D2

Review Product

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

2D1D2, PMP34

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

67635-1-PBS targets SLC25A17 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Mouse / IgG1
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag24456 Product name: Recombinant human SLC25A17 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 34-104 aa of BC012998 Sequence: RLRLQVDEKRKSKTTHMVLLEIIKEEGLLAPYRGWFPVISSLCCSNFVYFYTFNSLKALWVKGQHSTTGKD Predict reactive species
Full Name	solute carrier family 25 (mitochondrial carrier; peroxisomal membrane protein, 34kDa), member 17
Calculated Molecular Weight	307 aa, 35 kDa
Observed Molecular Weight	35 kDa
GenBank Accession Number	BC012998
Gene Symbol	SLC25A17
Gene ID (NCBI)	10478
RRID	AB_2882836
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	O43808
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

SLC25A17 (solute carrier family 25 member 17), is a kind of peroxisomal transporter for multiple cofactors such as CoA, FAD, FMN and AMP. It May catalyze the transport of free CoA, FAD and NAD+ from the cytosol into the peroxisomal matrix by a counter-exchange mechanism. SLC25A17 is the only member of the mitochondrial carrier family localized to peroxisomal. (PMID: 22185573, 32266253)