Product Information
67635-1-PBS targets SLC25A17 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag24456 Product name: Recombinant human SLC25A17 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 34-104 aa of BC012998 Sequence: RLRLQVDEKRKSKTTHMVLLEIIKEEGLLAPYRGWFPVISSLCCSNFVYFYTFNSLKALWVKGQHSTTGKD Predict reactive species |
Full Name | solute carrier family 25 (mitochondrial carrier; peroxisomal membrane protein, 34kDa), member 17 |
Calculated Molecular Weight | 307 aa, 35 kDa |
Observed Molecular Weight | 35 kDa |
GenBank Accession Number | BC012998 |
Gene Symbol | SLC25A17 |
Gene ID (NCBI) | 10478 |
RRID | AB_2882836 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | O43808 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
SLC25A17 (solute carrier family 25 member 17), is a kind of peroxisomal transporter for multiple cofactors such as CoA, FAD, FMN and AMP. It May catalyze the transport of free CoA, FAD and NAD+ from the cytosol into the peroxisomal matrix by a counter-exchange mechanism. SLC25A17 is the only member of the mitochondrial carrier family localized to peroxisomal. (PMID: 22185573, 32266253)