Filter: AllWBIHC

WB analysis using 67635-1-Ig
Various lysates were subjected to SDS PAGE followed by western blot with 67635-1-Ig (SLC25A17 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Beta Actin Monoclonal antibody (HRP-66009) as loading control.
WB analysis of U2OS using 67635-1-Ig
U2OS cells were subjected to SDS PAGE followed by western blot with 67635-1-Ig (SLC25A17 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.
WB analysis of A549 using 67635-1-Ig
A549 cells were subjected to SDS PAGE followed by western blot with 67635-1-Ig (SLC25A17 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.
IHC staining of human liver cancer using 67635-1-Ig
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67635-1-Ig (SLC25A17 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human liver cancer using 67635-1-Ig
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67635-1-Ig (SLC25A17 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human liver cancer using 67635-1-Ig
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67635-1-Ig (SLC25A17 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human liver cancer using 67635-1-Ig
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67635-1-Ig (SLC25A17 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human liver using 67635-1-Ig
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 67635-1-Ig (SLC25A17 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human liver using 67635-1-Ig
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 67635-1-Ig (SLC25A17 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of mouse liver using 67635-1-Ig
Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 67635-1-Ig (SLC25A17 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of mouse liver using 67635-1-Ig
Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 67635-1-Ig (SLC25A17 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

SLC25A17 Monoclonal antibody

Name: SLC25A17 Monoclonal antibody
Brand: Proteintech
SKU: 67635-1-Ig

SLC25A17 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 67635-1-Ig

Clone No.2D1D2

Review Product

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

2D1D2, PMP34

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	MCF-7 cells, U2OS cells, A549 cells, HeLa cells, HepG2 cells, K-562 cells, Jurkat cells
Positive IHC detected in	human liver cancer tissue, human liver tissue, mouse liver tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:5000-1:50000
Immunohistochemistry (IHC)	IHC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67635-1-Ig targets SLC25A17 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Mouse / IgG1
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag24456 Product name: Recombinant human SLC25A17 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 34-104 aa of BC012998 Sequence: RLRLQVDEKRKSKTTHMVLLEIIKEEGLLAPYRGWFPVISSLCCSNFVYFYTFNSLKALWVKGQHSTTGKD Predict reactive species
Full Name	solute carrier family 25 (mitochondrial carrier; peroxisomal membrane protein, 34kDa), member 17
Calculated Molecular Weight	307 aa, 35 kDa
Observed Molecular Weight	35 kDa
GenBank Accession Number	BC012998
Gene Symbol	SLC25A17
Gene ID (NCBI)	10478
RRID	AB_2882836
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein G purification
UNIPROT ID	O43808
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC25A17 (solute carrier family 25 member 17), is a kind of peroxisomal transporter for multiple cofactors such as CoA, FAD, FMN and AMP. It May catalyze the transport of free CoA, FAD and NAD+ from the cytosol into the peroxisomal matrix by a counter-exchange mechanism. SLC25A17 is the only member of the mitochondrial carrier family localized to peroxisomal. (PMID: 22185573, 32266253)