Filter: AllWBIHC

WB analysis of mouse kidney using 21764-1-AP
mouse kidney tissue were subjected to SDS PAGE followed by western blot with 21764-1-AP (SLC25A2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
WB analysis of mouse liver using 21764-1-AP
mouse liver tissue were subjected to SDS PAGE followed by western blot with 21764-1-AP (SLC25A2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.
WB analysis of HeLa using 21764-1-AP
HeLa cells were subjected to SDS PAGE followed by western blot with 21764-1-AP (SLC25A2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
IHC staining of human liver using 21764-1-AP
Immunohistochemical analysis of paraffin-embedded human liver using 21764-1-AP (SLC25A2 antibody) at dilution of 1:50 (under 10x lens).
IHC staining of human liver using 21764-1-AP
Immunohistochemical analysis of paraffin-embedded human liver using 21764-1-AP (SLC25A2 antibody) at dilution of 1:50 (under 40x lens).
IHC staining of human kidney using 21764-1-AP
Immunohistochemical analysis of paraffin-embedded human kidney using 21764-1-AP (SLC25A2 antibody) at dilution of 1:50 (under 10x lens).
IHC staining of human kidney using 21764-1-AP
Immunohistochemical analysis of paraffin-embedded human kidney using 21764-1-AP (SLC25A2 antibody) at dilution of 1:50 (under 40x lens).

SLC25A2 Polyclonal antibody

Name: SLC25A2 Polyclonal antibody
Brand: Proteintech
SKU: 21764-1-AP

Cat No. 21764-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

ORC2, ORNT2, SLC25A2

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

Positive WB detected in	mouse kidney tissue, HeLa cells, mouse liver tissue
Positive IHC detected in	human liver tissue, human kidney tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Application	Dilution
Western Blot (WB)	WB : 1:500-1:3000
Immunohistochemistry (IHC)	IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

WB	See 1 publications below

21764-1-AP targets SLC25A2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag16360 Product name: Recombinant human SLC25A2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 21-101 aa of BC100935 Sequence: TACVLTGQPFDTIKVKMQTFPDLYKGLTDCFLKTYAQVGLRGFYKGTGPALMAYVAENSVLFMCYGFCQQFVRKVAGMDKQ Predict reactive species
Full Name	solute carrier family 25 (mitochondrial carrier; ornithine transporter) member 2
Calculated Molecular Weight	301 aa, 33 kDa
Observed Molecular Weight	30-33 kDa
GenBank Accession Number	BC100935
Gene Symbol	SLC25A2
Gene ID (NCBI)	83884
RRID	AB_10858388
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9BXI2
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Product Specific Protocols
IHC protocol for SLC25A2 antibody 21764-1-AP	Download protocol
WB protocol for SLC25A2 antibody 21764-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Species	Application	Title
human	WB	PLoS One Effects of canagliflozin on growth and metabolic reprograming in hepatocellular carcinoma cells: Multi-omics analysis of metabolomics and absolute quantification proteomics (iMPAQT). Authors - Dan Nakano View Article