SLC25A2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SLC25A2 Polyclonal antibody (21764-1-AP)

SLC25A2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 21764-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

ORC2, ORNT2, SLC25A2

• 

  WB analysis of mouse kidney using 21764-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 21764-1-AP (SLC25A2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse liver using 21764-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 21764-1-AP (SLC25A2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 21764-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 21764-1-AP (SLC25A2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 21764-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 21764-1-AP (SLC25A2 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 21764-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 21764-1-AP (SLC25A2 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 21764-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 21764-1-AP (SLC25A2 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 21764-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 21764-1-AP (SLC25A2 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: mouse kidney tissue, HeLa cells, mouse liver tissue
• Positive IHC detected in: human liver tissue, human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21764-1-AP targets SLC25A2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16360

  Product name: Recombinant human SLC25A2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 21-101 aa of BC100935

  Sequence: TACVLTGQPFDTIKVKMQTFPDLYKGLTDCFLKTYAQVGLRGFYKGTGPALMAYVAENSVLFMCYGFCQQFVRKVAGMDKQ

• Full Name: solute carrier family 25 (mitochondrial carrier; ornithine transporter) member 2
• Calculated Molecular Weight: 301 aa, 33 kDa
• Observed Molecular Weight: 30-33 kDa
• GenBank Accession Number: BC100935
• Gene Symbol: SLC25A2
• Gene ID (NCBI): 83884
• RRID: AB_10858388
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BXI2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	PLoS One; Effects of canagliflozin on growth and metabolic reprograming in hepatocellular carcinoma cells: Multi-omics analysis of metabolomics and absolute quantification proteomics (iMPAQT).; Authors - Dan Nakano