SLC25A36 Polyclonal antibody

• 

  WB analysis using 26379-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26379-1-AP (SLC25A36 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HepG2 using 26379-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using SLC25A36 antibody (26379-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-phalloidin (red).

SLC25A36 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 26379-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

Solute carrier family 25 member 36

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26379-1-AP targets SLC25A36 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23894

  Product name: Recombinant human SLC25A36 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 97-184 aa of BC014064

  Sequence: IYFAAYSNCKEKLNDVFDPDSTQVHMISAAMAGFTAITATNPIWLIKTRLQLDARNRGERRMGAFECVRKVYQTDGLKGFYRGMSASY

• Full Name: solute carrier family 25, member 36
• Observed Molecular Weight: 32-34 kDa
• GenBank Accession Number: BC014064
• Gene Symbol: SLC25A36
• Gene ID (NCBI): 55186
• RRID: AB_3669532
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96CQ1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC25A36 is a pyrimidine nucleotide carrier that belongs to the solute carrier family 25 (SLC25). SLC25A36 transports cytosine and uracil (deoxy)nucleosides monophosphate, diphosphate, and triphosphate via uniporter and antiporter(PMID: 25320081). It plays an important role in maintaining mitochondrial biogenesis. Loss of SLC25A36 in mouse embryonic stem cells (mESCs) is associated with mtDNA loss and mitochondrial dysfunction(PMID: 31036718).