SLC25A36 Monoclonal antibody, PBS Only

• 

  WB analysis using 67896-1-Ig (same clone as 67896-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67896-1-Ig (SLC25A36 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Beta Actin Monoclonal antibody (HRP-66009) as loading control. This data was developed using the same antibody clone with 67896-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67896-1-Ig (same clone as 67896-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67896-1-Ig (SLC25A36 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67896-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67896-1-Ig (same clone as 67896-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67896-1-Ig (SLC25A36 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67896-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 67896-1-Ig (same clone as 67896-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using SLC25A36 antibody (67896-1-Ig, Clone: 1E5E4 ) at dilution of 1:1000 and Multi-rAb CoraLite® Plus 594-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (Cat.NO. RGAM004 ). This data was developed using the same antibody clone with 67896-1-PBS in a different storage buffer formulation.

SLC25A36 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 67896-1-PBS

Clone No.1E5E4

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Solute carrier family 25 member 36, 1E5E4

---

Product Information

67896-1-PBS targets SLC25A36 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23894

  Product name: Recombinant human SLC25A36 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 97-184 aa of BC014064

  Sequence: IYFAAYSNCKEKLNDVFDPDSTQVHMISAAMAGFTAITATNPIWLIKTRLQLDARNRGERRMGAFECVRKVYQTDGLKGFYRGMSASY

• Full Name: solute carrier family 25, member 36
• GenBank Accession Number: BC014064
• Gene Symbol: SLC25A36
• Gene ID (NCBI): 55186
• RRID: AB_2918652
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q96CQ1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.