SLC25A36 Monoclonal antibody

• 

  WB analysis using 67896-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67896-1-Ig (SLC25A36 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Beta Actin Monoclonal antibody (HRP-66009) as loading control.

• 

  IHC staining of human breast cancer using 67896-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67896-1-Ig (SLC25A36 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 67896-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67896-1-Ig (SLC25A36 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A431 using 67896-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using SLC25A36 antibody (67896-1-Ig, Clone: 1E5E4 ) at dilution of 1:1000 and Multi-rAb CoraLite® Plus 594-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (Cat.NO. RGAM004 ).

SLC25A36 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67896-1-Ig

Clone No.1E5E4

Publications(1)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Solute carrier family 25 member 36, 1E5E4

---

Tested Applications

• Positive WB detected in: LNCaP cells, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, PC-12 cells, NIH/3T3 cells, 4T1 cells
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

67896-1-Ig targets SLC25A36 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23894

  Product name: Recombinant human SLC25A36 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 97-184 aa of BC014064

  Sequence: IYFAAYSNCKEKLNDVFDPDSTQVHMISAAMAGFTAITATNPIWLIKTRLQLDARNRGERRMGAFECVRKVYQTDGLKGFYRGMSASY

• Full Name: solute carrier family 25, member 36
• GenBank Accession Number: BC014064
• Gene Symbol: SLC25A36
• Gene ID (NCBI): 55186
• RRID: AB_2918652
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q96CQ1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Inherit Metab Dis; Hyperinsulinism / hyperammonemia syndrome caused by biallelic SLC25A36 mutation; Authors - Amit Safran