SLC25A39 Polyclonal antibody, PBS Only

• 

  WB analysis using 14963-1-AP (same clone as 14963-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 14963-1-AP (SLC25A39 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14963-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 14963-1-AP (same clone as 14963-1-PBS)

  mouse brain tissue was subjected to SDS PAGE followed by western blot with 14963-1-AP (SLC25A39 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14963-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

SLC25A39 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 14963-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

14963-1-PBS targets SLC25A39 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6825

  Product name: Recombinant human SLC25A39 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-351 aa of BC001398

  Sequence: MADQDPAGISPLQQMVASGTGAVVTSLFMTPLDVVKVRLQSQRPSMASELMPSSRLWSLSYTKWKCLLYCNGVLEPLYLCPNGARCATWFQDPTRFTGTMDAFVKIVRHEGTRTLWSGLPATLVMTVPATAIYFTAYDQLKAFLCGRALTSDLYAPMVAGALARLGTVTVISPLELMRTKLQAQHVSYRELGACVRTAVAQGGWRSLWLGWGPTALRDVPFSALYWFNYELVKSWLNGFRPKDQTSVGMSFVAGGISGTVAAVLTLPFDVVKTQRQVALGAMEAVRVNPLHVDSTWLLLRRIRAESGTKGLFAGFLPRIIKAAPSCAIMISTYEFGKSFFQRLNQDRLLGG

• Full Name: solute carrier family 25, member 39
• Calculated Molecular Weight: 39 kDa
• Observed Molecular Weight: 37-39 kDa
• GenBank Accession Number: BC001398
• Gene Symbol: SLC25A39
• Gene ID (NCBI): 51629
• RRID: AB_2878095
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BZJ4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SLC25A39, a member of the mitochondrial carrier family, is a mitochondrial transporter for basic amino acids localized to mitochondria. SLC25A39 can be expressed in human testis, kidney, heart, brain, liver and spleen. It has been reported that SLC25A39 is essential for heme biosynthesis in mammals. SLC25A29 is associated with mitochondrial protein synthesis and amino acid degradation. (PMID: 19656490, 11139402, 24652292)