SLC25A46 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SLC25A46 Polyclonal antibody, PBS Only (12277-1-PBS)

• 

  WB analysis using 12277-1-AP (same clone as 12277-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12277-1-AP (SLC25A46 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12277-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 12277-1-AP (same clone as 12277-1-PBS)

  WB result of SLC25A46 antibody (12277-1-AP; 1:1500; incubated at room temperature for 1.5 hours) with sh-Control and sh-SLC25A46 transfected Jurkat cells. This data was developed using the same antibody clone with 12277-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 12277-1-AP (same clone as 12277-1-PBS)

  WB result of SLC25A46 antibody (12277-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SLC25A46 transfected Jurkat cells. This data was developed using the same antibody clone with 12277-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 12277-1-AP (same clone as 12277-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12277-1-AP (SLC25A46 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12277-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach using 12277-1-AP (same clone as 12277-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 12277-1-AP (SLC25A46 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12277-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 12277-1-AP (same clone as 12277-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using SLC25A46 antibody (12277-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 12277-1-PBS in a different storage buffer formulation.

• 

  IF Staining of Jurkat using 12277-1-AP (same clone as 12277-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed Jurkat cells using SLC25A46 antibody (12277-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 12277-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

SLC25A46 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 12277-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Mitochondrial outer membrane protein SLC25A46, TB1

---

Product Information

12277-1-PBS targets SLC25A46 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2923

  Product name: Recombinant human SLC25A46 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-264 aa of BC017169

  Sequence: MHPRRPDGFDGLGYRGGARDEQGFGGAFPARSFSTGSDLGHWVTTPPDIPGSRNLHWGEKSPPYGVPTTSTPYEGPTEEPFSSGGGGSVQGQSSEQLNRFAGFGIGLASLFTENVLAHPCIVLRRQCQVNYHAQHYHLTPFTVINIMYSFNKTQGPRALWKGMGSTFIVQGVTLGAEGIISEFTPLPREVLHKWSPKQIGEHLLLKSLTYVVAMPFYSASLIETVQSEIIRDNTGILECVKEGIGRVIGMGVPHSKRLLPLLSL

• Full Name: solute carrier family 25, member 46
• Calculated Molecular Weight: 418 aa, 46 kDa
• Observed Molecular Weight: 46 kDa
• GenBank Accession Number: BC017169
• Gene Symbol: SLC25A46
• Gene ID (NCBI): 91137
• RRID: AB_2239384
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96AG3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SLC25A46 belongs to the SLC25 family of mitochondrial carrier proteins.