SLC2A9 Monoclonal antibody, PBS Only

• 

  WB analysis using 67530-1-Ig (same clone as 67530-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67530-1-Ig (SLC2A9 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67530-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67530-1-Ig (same clone as 67530-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67530-1-Ig (SLC2A9 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67530-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67530-1-Ig (same clone as 67530-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67530-1-Ig (SLC2A9 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67530-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 67530-1-Ig (same clone as 67530-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 67530-1-Ig (SLC2A9 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67530-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human hepatocirrhosis using 67530-1-Ig (same clone as 67530-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis tissue slide using 67530-1-Ig (SLC2A9 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67530-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human hepatocirrhosis using 67530-1-Ig (same clone as 67530-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis tissue slide using 67530-1-Ig (SLC2A9 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67530-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 67530-1-Ig (same clone as 67530-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 67530-1-Ig (SLC2A9 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67530-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human hepatocirrhosis using 67530-1-Ig (same clone as 67530-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human hepatocirrhosis tissue using SLC2A9 antibody (67530-1-Ig, Clone: 2D6E1 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67530-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human kidney using 67530-1-Ig (same clone as 67530-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human kidney tissue using SLC2A9 antibody (67530-1-Ig, Clone: 2D6E1 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67530-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human kidney using 67530-1-Ig (same clone as 67530-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human kidney tissue using SLC2A9 antibody (67530-1-Ig, Clone: 2D6E1 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67530-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human hepatocirrhosis using 67530-1-Ig (same clone as 67530-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human hepatocirrhosis tissue using SLC2A9 antibody (67530-1-Ig, Clone: 2D6E1 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67530-1-PBS in a different storage buffer formulation.

SLC2A9 Monoclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 67530-1-PBS

Clone No.2D6E1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

2D6E1, GLUT9, GLUT-9, GLUTX, Urate transporter

---

Product Information

67530-1-PBS targets SLC2A9 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

• Tested Reactivity: human, mouse, rat, pig, rabbit
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24135

  Product name: Recombinant human SLC2A9 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 443-511 aa of BC018897

  Sequence: IQKSLDTYCFLVFATICITGAIYLYFVLPETKNRTYAEISQAFSKRNKAYPPEEKIDSAVTDGKINGRP

• Full Name: solute carrier family 2 (facilitated glucose transporter), member 9
• Calculated Molecular Weight: 540 aa, 59 kDa
• Observed Molecular Weight: 56-59 kDa
• GenBank Accession Number: BC018897
• Gene Symbol: SLC2A9
• Gene ID (NCBI): 56606
• RRID: AB_2882749
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9NRM0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.