Filter: AllWBIHCIF-P

WB analysis using 67530-1-Ig (same clone as 67530-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 67530-1-Ig (SLC2A9 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67530-1-PBS in a different storage buffer formulation.
WB analysis using 67530-1-Ig (same clone as 67530-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 67530-1-Ig (SLC2A9 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67530-1-PBS in a different storage buffer formulation.
WB analysis using 67530-1-Ig (same clone as 67530-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 67530-1-Ig (SLC2A9 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67530-1-PBS in a different storage buffer formulation.
IHC staining of human liver using 67530-1-Ig (same clone as 67530-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 67530-1-Ig (SLC2A9 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67530-1-PBS in a different storage buffer formulation.
IHC staining of human hepatocirrhosis using 67530-1-Ig (same clone as 67530-1-PBS)
Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis tissue slide using 67530-1-Ig (SLC2A9 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67530-1-PBS in a different storage buffer formulation.
IHC staining of human hepatocirrhosis using 67530-1-Ig (same clone as 67530-1-PBS)
Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis tissue slide using 67530-1-Ig (SLC2A9 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67530-1-PBS in a different storage buffer formulation.
IHC staining of human liver using 67530-1-Ig (same clone as 67530-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 67530-1-Ig (SLC2A9 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67530-1-PBS in a different storage buffer formulation.
IF Staining of human hepatocirrhosis using 67530-1-Ig (same clone as 67530-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed human hepatocirrhosis tissue using SLC2A9 antibody (67530-1-Ig, Clone: 2D6E1 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67530-1-PBS in a different storage buffer formulation.
IF Staining of human kidney using 67530-1-Ig (same clone as 67530-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed human kidney tissue using SLC2A9 antibody (67530-1-Ig, Clone: 2D6E1 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67530-1-PBS in a different storage buffer formulation.
IF Staining of human kidney using 67530-1-Ig (same clone as 67530-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed human kidney tissue using SLC2A9 antibody (67530-1-Ig, Clone: 2D6E1 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67530-1-PBS in a different storage buffer formulation.
IF Staining of human hepatocirrhosis using 67530-1-Ig (same clone as 67530-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed human hepatocirrhosis tissue using SLC2A9 antibody (67530-1-Ig, Clone: 2D6E1 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67530-1-PBS in a different storage buffer formulation.

SLC2A9 Monoclonal antibody, PBS Only

SLC2A9 Monoclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 67530-1-PBS

Clone No.2D6E1

Review Product

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

2D6E1, GLUT9, GLUT-9, GLUTX, Urate transporter

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

67530-1-PBS targets SLC2A9 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

Tested Reactivity	human, mouse, rat, pig, rabbit
Host / Isotype	Mouse / IgG1
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag24135 Product name: Recombinant human SLC2A9 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 443-511 aa of BC018897 Sequence: IQKSLDTYCFLVFATICITGAIYLYFVLPETKNRTYAEISQAFSKRNKAYPPEEKIDSAVTDGKINGRP Predict reactive species
Full Name	solute carrier family 2 (facilitated glucose transporter), member 9
Calculated Molecular Weight	540 aa, 59 kDa
Observed Molecular Weight	56-59 kDa
GenBank Accession Number	BC018897
Gene Symbol	SLC2A9
Gene ID (NCBI)	56606
RRID	AB_2882749
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein G purification
UNIPROT ID	Q9NRM0
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.