Tested Applications
| Positive WB detected in | SMMC-7721 cells, pig liver tissue, HepG2 cells, L02 cells, HuH-7 cells, rat liver tissue, mouse liver tissue, rabbit liver tissue, HSC-T6 cells |
| Positive IHC detected in | human liver tissue, human hepatocirrhosis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human hepatocirrhosis tissue, human kidney tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67530-1-Ig targets SLC2A9 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.
| Tested Reactivity | human, mouse, rat, pig, rabbit |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24135 Product name: Recombinant human SLC2A9 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 443-511 aa of BC018897 Sequence: IQKSLDTYCFLVFATICITGAIYLYFVLPETKNRTYAEISQAFSKRNKAYPPEEKIDSAVTDGKINGRP Predict reactive species |
| Full Name | solute carrier family 2 (facilitated glucose transporter), member 9 |
| Calculated Molecular Weight | 540 aa, 59 kDa |
| Observed Molecular Weight | 56-59 kDa |
| GenBank Accession Number | BC018897 |
| Gene Symbol | SLC2A9 |
| Gene ID (NCBI) | 56606 |
| RRID | AB_2882749 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q9NRM0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SLC2A9 antibody 67530-1-Ig | Download protocol |
| IHC protocol for SLC2A9 antibody 67530-1-Ig | Download protocol |
| WB protocol for SLC2A9 antibody 67530-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The SLC2A9 Monoclonal antibody (Cat# 67530-1-Ig) has 22 citations across journals including Pharmacological Research, NPJ Science of Food, Journal of Ethnopharmacology, Food & Function, Communications Biology, International Immunopharmacology, Frontiers in Pharmacology, Bioorganic Chemistry, Metabolites, Journal of Nutrition, Journal of Food Science, Journal of Pharmaceutical Pharmacology, Food and Chemical Toxicology, and others. Research fields center on hyperuricemia, uric acid transport, renal protection, gut microbiota modulation, and natural product/pharmacological interventions targeting urate excretion pathways.
| Species | Application | Title |
|---|---|---|
Pharmacol Res A multi-component intervention enhances intestinal urate excretion and improves metabolic and immune homeostasis in diet-induced hyperuricemia. | ||
NPJ Sci Food Pediococcus acidilactici GR-5 alleviates hyperuricemia by degrading purine nucleosides and improving gut microbiota metabolism | ||
Curr Res Food Sci Effects of polysaccharides-riched Prunus mume fruit juice concentrate on uric acid excretion and gut microbiota in mice with adenine-induced chronic kidney disease | ||
Biomed Pharmacother Sanghuangporus vaninii ethanol extract alleviates hyperuricemic renal injury by regulating the uric acid transporters and inhibiting HK-2 apoptosis | ||
J Ethnopharmacol Evaluation of anti-hyperuricemic and nephroprotective activities and discovery of new XOD inhibitors of Morus alba L. root bark | ||
J Ethnopharmacol Xanthoceras sorbifolium leaves alleviate hyperuricemic nephropathy by inhibiting the PI3K/AKT signaling pathway to regulate uric acid transport |
