Product Information
26548-1-PBS targets SLC33A1 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24323 Product name: Recombinant human SLC33A1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-73 aa of BC014416 Sequence: MSPTISHKDSSRQRRPGNFSHSLDMKSGPLPPGGWDDSHLDSAGREGDREALLGDTGTGDFLKAPQSFRAELS Predict reactive species |
| Full Name | solute carrier family 33 (acetyl-CoA transporter), member 1 |
| Calculated Molecular Weight | 549 aa, 61 kDa |
| Observed Molecular Weight | 60-62 kDa |
| GenBank Accession Number | BC014416 |
| Gene Symbol | SLC33A1 |
| Gene ID (NCBI) | 9197 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O00400 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
SLC33A1 mediates active acetyl-CoA import through the endoplasmic reticulum (ER) membrane into the ER lumen where specific ER-based acetyl-CoA:lysine acetyltransferases are responsible for the acetylation of ER-based protein substrates.

