Tested Applications
| Positive WB detected in | A549 cells, mouse brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
25526-1-AP targets SLC35F2 in WB, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag20901 Product name: Recombinant human SLC35F2 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 1-132 aa of BC039195 Sequence: MEADSPAGPGAPEPLAEGAAAEFSSLLRRIKGKLFTWNILKTIALGQMLSLCICGTAITSQYLAERYKVNTPMLQSFINYCLLFLIYTVMLAFRSGSDNLLVILKRKWWKYILLGLADVEANYVIVRAYQYT Predict reactive species |
| Full Name | solute carrier family 35, member F2 |
| Calculated Molecular Weight | 374 aa, 41 kDa |
| Observed Molecular Weight | 41-50 kDa |
| GenBank Accession Number | BC039195 |
| Gene Symbol | SLC35F2 |
| Gene ID (NCBI) | 54733 |
| RRID | AB_2880119 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8IXU6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SLC35F2, also named as Solute carrier family 35 member F2, is a 374 amino acid protein, which belongs to the SLC35F solute transporter family. SLC35F2 as a Multi-pass membrane protein is a putative solute transporter. SLC35F2 is highly homologous to the lung squamous cell cancer-related gene, LSCC3, which is highly expressed in lung squamous cell tumour tissues. However, the clinical implication of the SLC35F2 gene in tumour development and progression remains unclear.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for SLC35F2 antibody 25526-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Theranostics USP32 confers cancer cell resistance to YM155 via promoting ER-associated degradation of solute carrier protein SLC35F2 | ||
Mol Cancer Res Exploiting AR-Regulated Drug Transport to Induce Sensitivity to the Survivin Inhibitor YM155. | ||
Biochem Biophys Res Commun βTrCP1 promotes SLC35F2 protein ubiquitination and inhibits cancer progression in HeLa cells | ||
Onco Targets Ther Knockdown of SLC35F2 Inhibits the Proliferation and Metastasis of Bladder Cancer Cells.
| ||
Biochim Biophys Acta Gen Subj E3 ubiquitin ligase APC/CCdh1 regulates SLC35F2 protein turnover and inhibits cancer progression in HeLa cells |



