Tested Applications
Positive WB detected in | A549 cells, mouse brain tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 5 publications below |
IP | See 1 publications below |
Product Information
25526-1-AP targets SLC35F2 in WB, IP, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag20901 Product name: Recombinant human SLC35F2 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 1-132 aa of BC039195 Sequence: MEADSPAGPGAPEPLAEGAAAEFSSLLRRIKGKLFTWNILKTIALGQMLSLCICGTAITSQYLAERYKVNTPMLQSFINYCLLFLIYTVMLAFRSGSDNLLVILKRKWWKYILLGLADVEANYVIVRAYQYT Predict reactive species |
Full Name | solute carrier family 35, member F2 |
Calculated Molecular Weight | 374 aa, 41 kDa |
Observed Molecular Weight | 41-50 kDa |
GenBank Accession Number | BC039195 |
Gene Symbol | SLC35F2 |
Gene ID (NCBI) | 54733 |
RRID | AB_2880119 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q8IXU6 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SLC35F2, also named as Solute carrier family 35 member F2, is a 374 amino acid protein, which belongs to the SLC35F solute transporter family. SLC35F2 as a Multi-pass membrane protein is a putative solute transporter. SLC35F2 is highly homologous to the lung squamous cell cancer-related gene, LSCC3, which is highly expressed in lung squamous cell tumour tissues. However, the clinical implication of the SLC35F2 gene in tumour development and progression remains unclear.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for SLC35F2 antibody 25526-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Theranostics USP32 confers cancer cell resistance to YM155 via promoting ER-associated degradation of solute carrier protein SLC35F2 | ||
Mol Cancer Res Exploiting AR-Regulated Drug Transport to Induce Sensitivity to the Survivin Inhibitor YM155. | ||
Biochem Biophys Res Commun βTrCP1 promotes SLC35F2 protein ubiquitination and inhibits cancer progression in HeLa cells | ||
Onco Targets Ther Knockdown of SLC35F2 Inhibits the Proliferation and Metastasis of Bladder Cancer Cells.
| ||
Biochim Biophys Acta Gen Subj E3 ubiquitin ligase APC/CCdh1 regulates SLC35F2 protein turnover and inhibits cancer progression in HeLa cells |