SLC35F2 Polyclonal antibody

• 

  WB analysis of A549 using 25526-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 25526-1-AP (SLC35F2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 25526-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 25526-1-AP (SLC35F2 Antibody) at dilution of 1:300 incubated at 4 degree celsius over night.

• Featured Product
• KD/KO Validated

SLC35F2 Polyclonal Antibody for WB, ELISA

Cat No. 25526-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IP, ELISA

Synonyms

HSNOV1, SLC35F2

---

Tested Applications

• Positive WB detected in: A549 cells, mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 5 publications below
• IP: See 1 publications below

Product Information

25526-1-AP targets SLC35F2 in WB, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20901

  Product name: Recombinant human SLC35F2 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-132 aa of BC039195

  Sequence: MEADSPAGPGAPEPLAEGAAAEFSSLLRRIKGKLFTWNILKTIALGQMLSLCICGTAITSQYLAERYKVNTPMLQSFINYCLLFLIYTVMLAFRSGSDNLLVILKRKWWKYILLGLADVEANYVIVRAYQYT

• Full Name: solute carrier family 35, member F2
• Calculated Molecular Weight: 374 aa, 41 kDa
• Observed Molecular Weight: 41-50 kDa
• GenBank Accession Number: BC039195
• Gene Symbol: SLC35F2
• Gene ID (NCBI): 54733
• RRID: AB_2880119
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IXU6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC35F2, also named as Solute carrier family 35 member F2, is a 374 amino acid protein, which belongs to the SLC35F solute transporter family. SLC35F2 as a Multi-pass membrane protein is a putative solute transporter. SLC35F2 is highly homologous to the lung squamous cell cancer-related gene, LSCC3, which is highly expressed in lung squamous cell tumour tissues. However, the clinical implication of the SLC35F2 gene in tumour development and progression remains unclear.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Theranostics; USP32 confers cancer cell resistance to YM155 via promoting ER-associated degradation of solute carrier protein SLC35F2; Authors - Arun Pandian Chandrasekaran
human	WB	Mol Cancer Res; Exploiting AR-Regulated Drug Transport to Induce Sensitivity to the Survivin Inhibitor YM155.; Authors - Michael D Nyquist
human	WB,IP	Biochem Biophys Res Commun; βTrCP1 promotes SLC35F2 protein ubiquitination and inhibits cancer progression in HeLa cells; Authors - Jencia Carminha Colaco
human	WB	Onco Targets Ther; Knockdown of SLC35F2 Inhibits the Proliferation and Metastasis of Bladder Cancer Cells.; Authors - Mei Chen ; KD Validated
human	WB	Biochim Biophys Acta Gen Subj; E3 ubiquitin ligase APC/CCdh1 regulates SLC35F2 protein turnover and inhibits cancer progression in HeLa cells; Authors - Jencia Carminha Colaco