SLC36A1 Polyclonal antibody

• 

  WB analysis using 24775-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 24775-1-AP (SLC36A1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human small intestine using 24775-1-AP

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 24775-1-AP (SLC36A1 antibody) at dilution of 1:200 (under 0x lens).

• 

  IHC staining of human small intestine using 24775-1-AP

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 24775-1-AP (SLC36A1 antibody) at dilution of 1:200 (under 0x lens).

• Featured Product
• KD/KO Validated

SLC36A1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 24775-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, ELISA

Synonyms

TRAMD3, Proton-coupled amino acid transporter 1, PAT1, LYAAT1, hPAT1

---

Tested Applications

• Positive WB detected in: HeLa cells
• Positive IHC detected in: human small intestine tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 5 publications below

Product Information

24775-1-AP targets SLC36A1 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20594

  Product name: Recombinant human SLC36A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-50 aa of BC136437

  Sequence: MSTQRLRNEDYHDYSSTDVSPEESPSEGLNNLSSPGSYQRFGQSNSTTWF

• Full Name: solute carrier family 36 (proton/amino acid symporter), member 1
• Calculated Molecular Weight: 476 aa, 53 kDa
• Observed Molecular Weight: 43-53 kDa
• GenBank Accession Number: BC136437
• Gene Symbol: SLC36A1
• Gene ID (NCBI): 206358
• RRID: AB_2918086
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7Z2H8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	ACS Appl Mater Interfaces; Betaine-Based and Polyguanidine-Inserted Zwitterionic Micelle as a Promising Platform to Conquer the Intestinal Mucosal Barrier; Authors - Kedong Liu
human	WB	J Gastroenterol; High-throughput screening identified miR-7-2-3p and miR-29c-3p as metastasis suppressors in gallbladder carcinoma.; Authors - Kai Lu ; KD Validated
human	WB	J Biol Chem; TFE3-SLC36A1 axis promotes resistance to glucose starvation in kidney cancer cells; Authors - Suli Lv
human	WB	Photodiagnosis Photodyn Ther; Cell senescence-associated porphyrin metabolism affects the efficacy of aminolevulinic acid-photodynamic diagnosis in bladder cancer; Authors - Hung Wei Lai
mouse	WB	Free Radic Biol Med; Glycine recalibrates iron homeostasis of lens epithelial cells by blocking lysosome-dependent ferritin degradation; Authors - Ludi Wang