Tested Applications
Positive WB detected in | mouse kidney tissue, rat kidney tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:3000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
21352-1-AP targets SLC36A2 in WB, ELISA applications and shows reactivity with human, Mouse, Rat samples.
Tested Reactivity | human, Mouse, Rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag15742 Product name: Recombinant human SLC36A2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-70 aa of BC101101 Sequence: MSVTKSTEGPQGAVAIKLDLMSPPESAKKLENKDSTFLDESPSESAGLKKTKGITVFQALIHLVKGNMGT Predict reactive species |
Full Name | solute carrier family 36 (proton/amino acid symporter), member 2 |
Calculated Molecular Weight | 483 aa, 53 kDa |
Observed Molecular Weight | 53-60 kDa |
GenBank Accession Number | BC101101 |
Gene Symbol | SLC36A2 |
Gene ID (NCBI) | 153201 |
RRID | AB_3085653 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q495M3 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SLC36A2 encodes proton-coupled amino acid transporter 2 (PAT2), a high-affinity cotransporter of glycine and proline coupled with the uptake of a proton in kidney and muscles. The inactivation or reduced function of SLC36A2 is the predominant determinant of the inherited iminoglycinuria phenotype in humans.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for SLC36A2 antibody 21352-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |