SLC36A2 Polyclonal antibody

• 

  WB analysis using 21352-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21352-1-AP (SLC36A2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

SLC36A2 Polyclonal Antibody for WB, ELISA

Cat No. 21352-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, Mouse, Rat

Applications

WB, ELISA

Synonyms

PAT2, SLC36A2, TRAMD1, Tramdorin 1

---

Tested Applications

• Positive WB detected in: mouse kidney tissue, rat kidney tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21352-1-AP targets SLC36A2 in WB, ELISA applications and shows reactivity with human, Mouse, Rat samples.

• Tested Reactivity: human, Mouse, Rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15742

  Product name: Recombinant human SLC36A2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-70 aa of BC101101

  Sequence: MSVTKSTEGPQGAVAIKLDLMSPPESAKKLENKDSTFLDESPSESAGLKKTKGITVFQALIHLVKGNMGT

• Full Name: solute carrier family 36 (proton/amino acid symporter), member 2
• Calculated Molecular Weight: 483 aa, 53 kDa
• Observed Molecular Weight: 53-60 kDa
• GenBank Accession Number: BC101101
• Gene Symbol: SLC36A2
• Gene ID (NCBI): 153201
• RRID: AB_3085653
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q495M3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC36A2 encodes proton-coupled amino acid transporter 2 (PAT2), a high-affinity cotransporter of glycine and proline coupled with the uptake of a proton in kidney and muscles. The inactivation or reduced function of SLC36A2 is the predominant determinant of the inherited iminoglycinuria phenotype in humans.