Tested Applications
Positive WB detected in | mouse thymus tissue, HeLa cells, RAW 264.7 cells, mouse spleen tissue, rat thymus tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:300-1:600 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 2 publications below |
IHC | See 1 publications below |
Product Information
20469-1-AP targets SLC37A2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag14306 Product name: Recombinant human SLC37A2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 220-313 aa of BC051314 Sequence: VMGVITFLFLIEHPEDVDCAPPQHHGEPAENQDNPEDPGNSPCSIRESGLETVAKCSKGPCEEPAAISFFGALRIPGVVEFSLCLLFAKLVSYT Predict reactive species |
Full Name | solute carrier family 37 (glycerol-3-phosphate transporter), member 2 |
Calculated Molecular Weight | 505 aa, 55 kDa |
Observed Molecular Weight | 50-75 kDa |
GenBank Accession Number | BC051314 |
Gene Symbol | SLC37A2 |
Gene ID (NCBI) | 219855 |
RRID | AB_10733754 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q8TED4 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The solute carrier family 37 (SLC37) consists of four sugar-phosphate exchangers, A1, A2, A3, and A4, which are anchored in the endoplasmic reticulum (ER) membrane (PMID:23506893). Solute Carrier Family 37 Member 2 (SLC37A2), also knows as SPX2, was firstly identified in a work, conducted on mice and aimed to detect cAMP inducible genes playing a role in promoting cholesterol efflux from the macrophage cell line RAW264 via apoE and apoA1 (PMID:11004510). Interestingly, of the four SLC37A members, SLC37A2 displays the highest level of transcript abundance in neutrophils and macrophages ,indicating that SLC37A2 may play an essential role in regulating innate immune function (PMID:32428862).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for SLC37A2 antibody 20469-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cell Biol Toxicol hucMSC-Ex alleviates inflammatory bowel disease in mice by enhancing M2-type macrophage polarization via the METTL3-Slc37a2-YTHDF1 axis | ||
J Asian Nat Prod Res Chlorogenic acid targets SLC37A2 to inhibit macrophage activation via ER-dependent NF-κB and NLRP3 signaling pathways against sepsis-induced acute lung injury |