Product Information
20469-1-PBS targets SLC37A2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14306 Product name: Recombinant human SLC37A2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 220-313 aa of BC051314 Sequence: VMGVITFLFLIEHPEDVDCAPPQHHGEPAENQDNPEDPGNSPCSIRESGLETVAKCSKGPCEEPAAISFFGALRIPGVVEFSLCLLFAKLVSYT Predict reactive species |
| Full Name | solute carrier family 37 (glycerol-3-phosphate transporter), member 2 |
| Calculated Molecular Weight | 505 aa, 55 kDa |
| Observed Molecular Weight | 50-75 kDa |
| GenBank Accession Number | BC051314 |
| Gene Symbol | SLC37A2 |
| Gene ID (NCBI) | 219855 |
| RRID | AB_10733754 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8TED4 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
The solute carrier family 37 (SLC37) consists of four sugar-phosphate exchangers, A1, A2, A3, and A4, which are anchored in the endoplasmic reticulum (ER) membrane (PMID:23506893). Solute Carrier Family 37 Member 2 (SLC37A2), also knows as SPX2, was firstly identified in a work, conducted on mice and aimed to detect cAMP inducible genes playing a role in promoting cholesterol efflux from the macrophage cell line RAW264 via apoE and apoA1 (PMID:11004510). Interestingly, of the four SLC37A members, SLC37A2 displays the highest level of transcript abundance in neutrophils and macrophages ,indicating that SLC37A2 may play an essential role in regulating innate immune function (PMID:32428862).







