Tested Applications
Positive WB detected in | HepG2 cells, HeLa cells, mouse kidney tissue, mouse liver tissue, rat liver tissue |
Positive IHC detected in | human kidney tissue, human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 2 publications below |
IF | See 1 publications below |
Product Information
20612-1-AP targets SLC37A4 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag14660 Product name: Recombinant human SLC37A4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-93 aa of BC015650 Sequence: MAAQGYGYYRTVIFSAMFGGYSLYYFNRKTFSFVMPSLVEEIPLDKDDLGFITSSQSAAYAISKFVSGVLSDQMSARWLFSSGLLLVGLVNIF Predict reactive species |
Full Name | solute carrier family 37 (glucose-6-phosphate transporter), member 4 |
Calculated Molecular Weight | 429 aa, 46 kDa |
Observed Molecular Weight | 46 kDa |
GenBank Accession Number | BC015650 |
Gene Symbol | SLC37A4 |
Gene ID (NCBI) | 2542 |
RRID | AB_10858386 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O43826 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for SLC37A4 antibody 20612-1-AP | Download protocol |
IHC protocol for SLC37A4 antibody 20612-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cell Death Discov Circ_0000235 targets MCT4 to promote glycolysis and progression of bladder cancer by sponging miR-330-5p | ||
Sci Rep SLC37A4, gene responsible for glycogen storage disease type 1b, regulates gingival epithelial barrier function via JAM1 expression | ||
J Adv Res SRSF9 mediates oncogenic RNA splicing of SLC37A4 via liquid-liquid phase separation to promote oral cancer progression |