SLC37A4 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SLC37A4 Polyclonal antibody (20612-1-AP)

SLC37A4 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 20612-1-AP Copied!

Publications (5)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

Glucose-6-phosphate exchanger SLC37A4, Glucose-5-phosphate transporter, G6PT3, G6PT2, G6PT1

• 

  WB analysis of mouse liver using 20612-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 20612-1-AP (SLC37A4 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 20612-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20612-1-AP (SLC37A4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 20612-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 20612-1-AP (SLC37A4 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 20612-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 20612-1-AP (SLC37A4 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse kidney using 20612-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 20612-1-AP (SLC37A4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 20612-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 20612-1-AP (SLC37A4 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 20612-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 20612-1-AP (SLC37A4 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 20612-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 20612-1-AP (SLC37A4 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 20612-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 20612-1-AP (SLC37A4 antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 20612-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 20612-1-AP (SLC37A4 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 20612-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 20612-1-AP (SLC37A4 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SLC37A4 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HepG2 cells, HeLa cells, mouse kidney tissue, mouse liver tissue, rat liver tissue
• Positive IHC detected in: human kidney tissue, human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20612-1-AP targets SLC37A4 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14660

  Product name: Recombinant human SLC37A4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-93 aa of BC015650

  Sequence: MAAQGYGYYRTVIFSAMFGGYSLYYFNRKTFSFVMPSLVEEIPLDKDDLGFITSSQSAAYAISKFVSGVLSDQMSARWLFSSGLLLVGLVNIF

• Full Name: solute carrier family 37 (glucose-6-phosphate transporter), member 4
• Calculated Molecular Weight: 429 aa, 46 kDa
• Observed Molecular Weight: 46 kDa
• GenBank Accession Number: BC015650
• Gene Symbol: SLC37A4
• Gene ID (NCBI): 2542
• RRID: AB_10858386
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43826
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The SLC37A4 Polyclonal antibody (Cat# 20612-1-AP) has 5 citations published in J Adv Res, Cell Death Discov, Sci Rep, J Infect Chemother, and bioRxiv. Research fields span oncology (oral and bladder cancer), glycogen storage disease, gingival epithelial barrier function, autophagy signaling in Mycobacterium avium infection, and glucocorticoid homeostasis after bariatric surgery. Applications cited include WB and IF in human and mouse samples.

Automatically generated from the 5 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Adv Res; SRSF9 mediates oncogenic RNA splicing of SLC37A4 via liquid-liquid phase separation to promote oral cancer progression; Authors - Qiu Peng
human	WB	Cell Death Discov; Circ_0000235 targets MCT4 to promote glycolysis and progression of bladder cancer by sponging miR-330-5p; Authors - Jianye Zhong
human	IF	Sci Rep; SLC37A4, gene responsible for glycogen storage disease type 1b, regulates gingival epithelial barrier function via JAM1 expression; Authors - Keita Tanigaki
mouse	WB	J Infect Chemother; N-acetylcysteine is associated with restoration of autophagy-related signaling and reduced intracellular Mycobacterium avium in alveolar type 1 epithelial cells.; Authors - Ayako Shiozawa
		bioRxiv; Alterations in glucocorticoid homeostasis following sleeve gastrectomy; Authors - Seraina O Moser