Product Information
28632-1-PBS targets SLC38A1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag30088 Product name: Recombinant human SLC38A1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-74 aa of BC010620 Sequence: MMHFKSGLELTELQNMTVPEDDNISNDSNDFTEVENGQINSKFISDRESRRSLTNSHLEKKKCDEYIPGTTSLG Predict reactive species |
| Full Name | solute carrier family 38, member 1 |
| Calculated Molecular Weight | 487 aa, 54 kDa |
| Observed Molecular Weight | 54 kDa, 60-70 kDa |
| GenBank Accession Number | BC010620 |
| Gene Symbol | SLC38A1 |
| Gene ID (NCBI) | 81539 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9H2H9 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
SLC38A1 (Sodium-coupled neutral amino acid transporter 1), is also named as SNAT1, which is a symporter that cotransports short-chain neutral amino acids and sodium ions from the extraccellular to the intracellular side of the cell membrane (PMID:20599747, PMID:10891391). Inhibition of SLC38A1 reduced tumor growth, cellular migration, invasion, and induced senescence in melanoma cells (PMID:35565278). SLC38A1 was identified as a positive regulator of mTORC1 in neurons, which promoted ischemic brain damage by mTOR-autophagy system (PMID:31552299). SLC38A1 is mainly expressed in brain and placenta.







