Tested Applications
| Positive WB detected in | A549 cells, mouse brain tissue, mouse skeletal muscle tissue |
| Positive IHC detected in | mouse brain tissue, human placenta tissue, mouse lung tissue, human ovary cancer tissue, mouse cerebellum tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive FC (Intra) detected in | A549 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:14000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
28632-1-AP targets SLC38A1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag30088 Product name: Recombinant human SLC38A1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-74 aa of BC010620 Sequence: MMHFKSGLELTELQNMTVPEDDNISNDSNDFTEVENGQINSKFISDRESRRSLTNSHLEKKKCDEYIPGTTSLG Predict reactive species |
| Full Name | solute carrier family 38, member 1 |
| Calculated Molecular Weight | 487 aa, 54 kDa |
| Observed Molecular Weight | 54 kDa, 60-70 kDa |
| GenBank Accession Number | BC010620 |
| Gene Symbol | SLC38A1 |
| Gene ID (NCBI) | 81539 |
| RRID | AB_3086073 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9H2H9 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SLC38A1 (Sodium-coupled neutral amino acid transporter 1), is also named as SNAT1, which is a symporter that cotransports short-chain neutral amino acids and sodium ions from the extraccellular to the intracellular side of the cell membrane (PMID:20599747, PMID:10891391). Inhibition of SLC38A1 reduced tumor growth, cellular migration, invasion, and induced senescence in melanoma cells (PMID:35565278). SLC38A1 was identified as a positive regulator of mTORC1 in neurons, which promoted ischemic brain damage by mTOR-autophagy system (PMID:31552299). SLC38A1 is mainly expressed in brain and placenta.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for SLC38A1 antibody 28632-1-AP | Download protocol |
| IHC protocol for SLC38A1 antibody 28632-1-AP | Download protocol |
| WB protocol for SLC38A1 antibody 28632-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The SLC38A1 Polyclonal antibody (Cat# 28632-1-AP) has 12 citations. These appear in journals including Metabolism, Cell Reports in Medicine, Science Advances, Cancer Letters, Biomolecules, Experimental Gerontology, Cancers, Cell Signaling, Expert Review of Clinical Immunology, Discovery Oncology, and Nan Fang Yi Ke Da Xue Xue Bao. Research fields span cancer biology (colorectal, lung, renal, endometrial, and hepatocellular carcinoma), glutamine/amino acid metabolism, ferroptosis, vascular restenosis, preeclampsia, skeletal muscle aging, and placental transport. Applications include WB, IHC, and IF.
| Species | Application | Title |
|---|---|---|
Metabolism ALDH2 deficiency aggravates vascular injury-induced restenosis by enhancing vascular smooth muscle cell proliferation through SLC38A2-mediated upregulation of glutamine uptake. | ||
Cell Rep Med Nanoparticle-based serine replenishment rescues SP1-BNIP3 mitophagy and ameliorates preeclampsia in preclinical models. | ||
Sci Adv Liver regeneration-associated hepatocellular YAP1 activation prevents colorectal cancer liver metastasis through glutamine competition | ||
Cancer Lett Distinct Immunophenotypic Profiles and Neutrophil Heterogeneity in Colorectal Cancer | ||
Cancer Lett HHLA2 promotes immune evasion in EGFR-mutant lung cancer by inhibiting CD8(+) T cell glutamine metabolism via KIR3DL3 interaction. | ||
Biomolecules Targeting Sodium Transport Reveals CHP1 Downregulation as a Novel Molecular Feature of Malignant Progression in Clear Cell Renal Cell Carcinoma: Insights from Integrated Multi-Omics Analyses |
Reviews
What customers say
The single review for this product is a 5-star rating from a Western Blot application using a 1:1000 dilution on mouse tissue. The reviewer simply commented "good," indicating satisfactory performance. Overall, the feedback is positive, though limited in detail.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Bruna (Verified Customer) (06-18-2026) | good
 |
