Tested Applications
| Positive WB detected in | mouse heart tissue, mouse spleen tissue, rat heart tissue |
| Positive IHC detected in | mouse liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | U2OS cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 4 publications below |
| IHC | See 3 publications below |
Product Information
26540-1-AP targets SLC39A14/ZIP-14 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24210 Product name: Recombinant human SLC39A14 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 34-152 aa of BC015770 Sequence: GAPAISAASFLQDLIHRYGEGDSLTLQQLKALLNHLDVGVGRGNVTQHVQGHRNLSTCFSSGDLFTAHNFSEQSRIGSSELQEFCPTILQQLDSRACTSENQENEENEQTEEGRPSAVE Predict reactive species |
| Full Name | solute carrier family 39 (zinc transporter), member 14 |
| Calculated Molecular Weight | 54 kDa |
| Observed Molecular Weight | 54 kDa |
| GenBank Accession Number | BC015770 |
| Gene Symbol | SLC39A14/ZIP-14 |
| Gene ID (NCBI) | 23516 |
| RRID | AB_3085879 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q15043 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Metal cation symporter ZIP14 (SLC39A14) is an electroneutral transporter of the plasma membrane that mediates the cellular uptake of divalent metal cations zinc, manganese, and iron and is important for tissue homeostasis, metabolism, development and immunity (PubMed:15642354, PubMed:27231142, PubMed:29621230). The molecular weight is around 53-54 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SLC39A14/ZIP-14 antibody 26540-1-AP | Download protocol |
| IHC protocol for SLC39A14/ZIP-14 antibody 26540-1-AP | Download protocol |
| WB protocol for SLC39A14/ZIP-14 antibody 26540-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Front Mol Biosci Single-cell transcriptomics uncover the key ferroptosis regulators contribute to cancer progression in head and neck squamous cell carcinoma | ||
Free Radic Biol Med Ferredoxin 1-like maintains iron homeostasis and hepatoma cell survival | ||
Cell Signal Elucidating ferroptosis mechanisms in heart failure through transcriptomics, single-cell sequencing, and experimental validation | ||
Arthritis Res Ther Identification and verification of a novel signature that combines cuproptosis-related genes with ferroptosis-related genes in osteoarthritis using bioinformatics analysis and experimental validation | ||
JCI Insight NSD1-916aa encoded by CircNSD1 contributes to AKI-to-CKD transition through inducing ferroptosis in tubular epithelial cells | ||
Adv Sci (Weinh) Creatine Promotes Endometriosis by Inducing Ferroptosis Resistance via Suppression of PrP |





