Tested Applications
| Positive WB detected in | Caco-2 cells, mouse spleen tissue, HepG2 cells, mouse liver tissue, rat spleen, HEK-293T cells, SW480 cells |
| Positive IHC detected in | human liver tissue, mouse spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 115 publications below |
| IHC | See 7 publications below |
| IF | See 10 publications below |
| IP | See 1 publications below |
Product Information
26601-1-AP targets SLC40A1/FPN1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, chicken, zebrafish, bovine, sheep |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24273 Product name: Recombinant human SLC40A1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 398-500 aa of BC037733 Sequence: LDLSVSPFEDIRSRFIQGESITPTKIPEITTEIYMSNGSNSANIVPETSPESVPIISVSLLFAGVIAARIGLWSFDLTVTQLLQENVIESERGIINGVQNSMN Predict reactive species |
| Full Name | solute carrier family 40 (iron-regulated transporter), member 1 |
| Calculated Molecular Weight | 62 kDa |
| Observed Molecular Weight | 62-70 kDa |
| GenBank Accession Number | BC037733 |
| Gene Symbol | SLC40A1/Ferroportin |
| Gene ID (NCBI) | 30061 |
| RRID | AB_2880571 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NP59 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SLC40A1, also named as Ferroportin 1 (FPN1), is an iron transporter which is involved in iron export from duodenal epithelial cell and also in transfer of iron between maternal and fetal circulation. It has been reported that SLC40A1 mutations may lead to macrophage iron overload, hyperferritinemia, and normal transferrin saturation among ferroportin iron overload patients. This antibody detects 50-75 kDa protein as well as the fragments of 56 kDa and 35 kDa protein similar to papers in SDS-PAGE (PMID:32645092, 21396368,16054062, 18974313). SLC40A1 is mainly localized to the cell membrane, but may also be detected in the cytoplasm.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for SLC40A1/FPN1 antibody 26601-1-AP | Download protocol |
| WB protocol for SLC40A1/FPN1 antibody 26601-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun ACSS2 protects against alcohol-induced hepatocyte ferroptosis through regulation of hepcidin expression | ||
J Hazard Mater Investigating the potential risk of cadmium exposure on seizure severity and anxiety-like behaviors through the ferroptosis pathway in epileptic mice: An integrated multi-omics approach | ||
Redox Biol NCOA4-mediated ferritinophagy is involved in ionizing radiation-induced ferroptosis of intestinal epithelial cells. | ||
Sci Total Environ Effects of chronic low-level lead (Pb) exposure on cognitive function and hippocampal neuronal ferroptosis: An integrative approach using bioinformatics analysis, machine learning, and experimental validation | ||
Cell Death Dis Super-enhancer-driven MLX mediates redox balance maintenance via SLC7A11 in osteosarcoma |













