SLC43A2 Polyclonal antibody

SLC43A2 Polyclonal Antibody for WB, IHC, IF-P, FC (Intra), ELISA

Cat No. 30031-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, FC (Intra), ELISA

LAT4, L-type amino acid transporter 4, PP7664

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected in37°C incubated mouse kidney tissue, mouse kidney tissue, mouse liver tissue, mouse liver tissue (37℃ incubated), rat liver tissue
Positive IHC detected inhuman placenta tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman lung cancer tissue
Positive FC (Intra) detected inJurkat cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

30031-1-AP targets SLC43A2 in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag31341

Product name: Recombinant human SLC43A2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 516-569 aa of BC027923

Sequence: WVNVGLLLLSLLGFCLPLYLICYRRQLERQLQQRQEDDKLFLKINGSSNQEAFV

Predict reactive species
Full Name solute carrier family 43, member 2
Calculated Molecular Weight 63 kDa
Observed Molecular Weight 48-53 kDa
GenBank Accession NumberBC027923
Gene Symbol SLC43A2
Gene ID (NCBI) 124935
RRIDAB_3086213
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8N370
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC43A2 (solute carrier family 43 member 2, also known as LAT4) is a multi-pass transmembrane protein that mediates sodium- and chloride-independent uptake of large neutral amino acids, including methionine, leucine and phenylalanine. Highly expressed in kidney, placenta and liver, it supplies essential amino acids to support fetal growth, protein synthesis and one-carbon metabolism. Over-expressed in head-and-neck, liver and other cancers, SLC43A2-driven methionine influx maintains methylation reactions and YAP activity, promoting tumor proliferation and chemo-resistance . Pharmacological inhibition of SLC43A2 sensitizes tumors to therapy, highlighting its potential as a metabolic target. (PMID: 39747898; 15659399; 30379325)

Protocols

Product Specific Protocols
IF protocol for SLC43A2 antibody 30031-1-APDownload protocol
IHC protocol for SLC43A2 antibody 30031-1-APDownload protocol
WB protocol for SLC43A2 antibody 30031-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...