SLC6A12 Monoclonal antibody, PBS Only

• 

  WB analysis using 67700-1-Ig (same clone as 67700-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67700-1-Ig (SLC6A12 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67700-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67700-1-Ig (same clone as 67700-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67700-1-Ig (SLC6A12 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67700-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HSC-T6 using 67700-1-Ig (same clone as 67700-1-PBS)

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 67700-1-Ig (SLC6A12 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67700-1-PBS in a different storage buffer formulation.

• 

  IF Staining of Caco-2 using 67700-1-Ig (same clone as 67700-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed Caco-2 cells using SLC6A12 antibody (67700-1-Ig, Clone: 2C1G4 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67700-1-PBS in a different storage buffer formulation.

• 

  IF Staining of Caco-2 using 67700-1-Ig (same clone as 67700-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed Caco-2 cells using SLC6A12 antibody (67700-1-Ig, Clone: 2C1G4 ) at dilution of 1:800 and CoraLite®594-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67700-1-PBS in a different storage buffer formulation.

SLC6A12 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 67700-1-PBS

Clone No.2C1G4

Host / Isotype

Mouse / IgG2a

Reactivity

Human, Mouse, Rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

BGT 1, BGT1, FLJ38727, SLC6A12

---

Product Information

67700-1-PBS targets SLC6A12 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with Human, Mouse, Rat samples.

• Tested Reactivity: Human, Mouse, Rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18962

  Product name: Recombinant human SLC6A12 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 548-614 aa of BC126215

  Sequence: VCVPLFVVITLLKTRGPFRKRLRQLITPDSSLPQPKQHPCLDGSAGRNFGPSPTREGLIAGEKETHL

• Full Name: solute carrier family 6 (neurotransmitter transporter, betaine/GABA), member 12
• Calculated Molecular Weight: 614 aa, 69 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC126215
• Gene Symbol: SLC6A12
• Gene ID (NCBI): 6539
• RRID: AB_2882892
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P48065
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.