Tested Applications
| Positive WB detected in | L02 cells, rat liver tissue, HSC-T6 cells, HuH-7 cells, HepG2 cells, mouse hepatocytes |
| Positive IF/ICC detected in | Caco-2 cells |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.2 μg per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67700-1-Ig targets SLC6A12 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, pig, canine |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18962 Product name: Recombinant human SLC6A12 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 548-614 aa of BC126215 Sequence: VCVPLFVVITLLKTRGPFRKRLRQLITPDSSLPQPKQHPCLDGSAGRNFGPSPTREGLIAGEKETHL Predict reactive species |
| Full Name | solute carrier family 6 (neurotransmitter transporter, betaine/GABA), member 12 |
| Calculated Molecular Weight | 614 aa, 69 kDa |
| Observed Molecular Weight | 70 kDa |
| GenBank Accession Number | BC126215 |
| Gene Symbol | SLC6A12 |
| Gene ID (NCBI) | 6539 |
| RRID | AB_2882892 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P48065 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SLC6A12 antibody 67700-1-Ig | Download protocol |
| WB protocol for SLC6A12 antibody 67700-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The BGT1 (SLC6A12) antibody (Cat# 67700-1-Ig) has 6 total citations. Publications appear in Nature Communications, International Journal of Biological Sciences, Developmental Cell, Journal of Animal Science and Biotechnology, and American Journal of Physiology–Renal Physiology. Research fields span GABA/betaine transporter biology, hepatocellular carcinoma metastasis, brain metastasis targeting, macrophage pyroptosis in rheumatoid arthritis, hepatic lipid metabolism, and renal transporter trafficking.
| Species | Application | Title |
|---|---|---|
Nat Commun Substrate recognition and allosteric inhibition of human betaine/GABA transporter 1. | ||
Nat Commun Engineered zwitterion-nanodelivery for precision targeting of brain metastases. | ||
Int J Biol Sci Sodium chloride promotes macrophage pyroptosis and aggravates rheumatoid arthritis by activating SGK1 through GABA receptors Slc6a12 | ||
Dev Cell The de novo synthesis of GABA and its gene regulatory function control hepatocellular carcinoma metastasis | ||
J Anim Sci Biotechnol Betaine alleviates hepatic lipid metabolism disorder in finishing pigs fed a low-energy diet through regulating m(6)A RNA methylation. | ||
Am J Physiol Renal Physiol Mutation of a single threonine in the cytoplasmic NH2 terminus disrupts trafficking of renal betaine-GABA transporter 1 during hypertonic stress. |
Reviews
What customers say
The single review rates the antibody 3 out of 5 stars for Western Blot at a 1:2000 dilution, tested on HepG2 cells, mouse liver, and brain. The reviewer reports that the antibody works but produces a very weak signal at this dilution. They also note that the diluted antibody solution can only be used once. Overall, the feedback is mixed, with functional performance but concerns about signal strength and single-use limitation of the diluted preparation.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Hua (Verified Customer) (06-17-2021) | It works ok. The signal is very weak at 1:2000 dilution. The diluted antibody solution can only be used once.
|
