SLC6A12 Monoclonal antibody

• 

  WB analysis using 67700-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67700-1-Ig (SLC6A12 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 67700-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67700-1-Ig (SLC6A12 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HSC-T6 using 67700-1-Ig

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 67700-1-Ig (SLC6A12 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of Caco-2 using 67700-1-Ig

  Immunofluorescent analysis of (-20°C Methanol) fixed Caco-2 cells using SLC6A12 antibody (67700-1-Ig, Clone: 2C1G4 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

• 

  IF Staining of Caco-2 using 67700-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed Caco-2 cells using SLC6A12 antibody (67700-1-Ig, Clone: 2C1G4 ) at dilution of 1:800 and CoraLite®594-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

• 

  IF Staining of H9C2 using 67700-1-Ig

  Immunofluorescent analysis of (-20°C Methanol) fixed H9C2 cells using SLC6A12 antibody (67700-1-Ig, Clone: 2C1G4 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

• 

  FC experiment of HepG2 using 67700-1-Ig

  1x10^6 HepG2 cells were intracellularly stained with 0.2 μg SLC6A12 Monoclonal antibody (67700-1-Ig, Clone:2C1G4) and Multi-rAb CoraLite® Plus 647-Goat Anti-Mouse Recombinant Secondary Antibody (H+L)(RGAM005)(N/A), or 0.2 μg KLH (66360-2-Ig, Clone: K11A1B2A2) (N/A). Cells were fixed with 4% PFA .

SLC6A12 Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 67700-1-Ig

Clone No.2C1G4

Publications(3)

Reviews (1)

Host / Isotype

Mouse / IgG2a

Reactivity

Human, Mouse, Rat and More (3)

Applications

WB, IF/ICC, ELISA

Synonyms

BGT 1, BGT1, FLJ38727, SLC6A12

---

Tested Applications

• Positive WB detected in: L02 cells, rat liver tissue, HSC-T6 cells, HuH-7 cells, HepG2 cells, mouse hepatocytes
• Positive IF/ICC detected in: Caco-2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below

Product Information

67700-1-Ig targets SLC6A12 in WB, IF/ICC, ELISA applications and shows reactivity with Human, Mouse, Rat samples.

• Tested Reactivity: Human, Mouse, Rat
• Cited Reactivity: human, mouse, canine
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18962

  Product name: Recombinant human SLC6A12 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 548-614 aa of BC126215

  Sequence: VCVPLFVVITLLKTRGPFRKRLRQLITPDSSLPQPKQHPCLDGSAGRNFGPSPTREGLIAGEKETHL

• Full Name: solute carrier family 6 (neurotransmitter transporter, betaine/GABA), member 12
• Calculated Molecular Weight: 614 aa, 69 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC126215
• Gene Symbol: SLC6A12
• Gene ID (NCBI): 6539
• RRID: AB_2882892
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P48065
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
canine	WB	Am J Physiol Renal Physiol; Mutation of a single threonine in the cytoplasmic NH2 terminus disrupts trafficking of renal betaine-GABA transporter 1 during hypertonic stress.; Authors - Eva S Schweikhard
mouse	WB	Int J Biol Sci; Sodium chloride promotes macrophage pyroptosis and aggravates rheumatoid arthritis by activating SGK1 through GABA receptors Slc6a12; Authors - Xianzheng Zhang
human	WB	Dev Cell; The de novo synthesis of GABA and its gene regulatory function control hepatocellular carcinoma metastasis; Authors - Li Li

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Hua (Verified Customer) (06-17-2021)

It works ok. The signal is very weak at 1:2000 dilution. The diluted antibody solution can only be used once.

• Applications: Western Blot
• Primary Antibody Dilution: 1:2000
• Cell Tissue Type: HepG2, mouse liver and brain