SLC6A19 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SLC6A19 Polyclonal antibody, PBS Only (29372-1-PBS)

• 

  WB analysis using 29372-1-AP (same clone as 29372-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29372-1-AP (SLC6A19 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29372-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 29372-1-AP (same clone as 29372-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29372-1-AP (SLC6A19 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29372-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human small intestine using 29372-1-AP (same clone as 29372-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 29372-1-AP (SLC6A19 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29372-1-PBS in a different storage buffer formulation.

SLC6A19 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 29372-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

B0AT1, HND, Sodium-dependent neutral amino acid transporter B(0)AT1

---

Product Information

29372-1-PBS targets SLC6A19 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31076

  Product name: Recombinant human SLC6A19 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 142-192 aa of BC148801

  Sequence: NSFQEPLPWSDCPLNENQTGYVDECARSSPVDYFWYRETLNISTSISDSGS

• Full Name: solute carrier family 6 (neutral amino acid transporter), member 19
• Calculated Molecular Weight: 634 aa, 71 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC148801
• Gene Symbol: SLC6A19
• Gene ID (NCBI): 340024
• RRID: AB_2918286
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q695T7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SLC6A19, also named as B0AT1, encodes system B(0) transmembrane protein that mediates epithelial resorption of neutral amino acids across the apical membrane in kidney and intestine (PubMed: 15044460). The protein contains 634 amino acids and has 12 predicted transmembrane regions with highly expression in human kidney and small intestine and minimal in pancreas (PubMed: 15286787). The expression of SLC6A19 in intestinal cells depends on angiotensin converting enzyme 2 which is the cellular receptor for SARS-CoV-2 (PubMed: 32132184). Mutations in SLC6A19 cause Hartnup disease (PMID: 15286787, PMID: 15286788).