SLC6A19 Polyclonal antibody

• 

  WB analysis using 29372-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29372-1-AP (SLC6A19 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 29372-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29372-1-AP (SLC6A19 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human kidney using 29372-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 29372-1-AP (SLC6A19 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 29372-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 29372-1-AP (SLC6A19 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human small intestine using 29372-1-AP

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 29372-1-AP (SLC6A19 antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human small intestine using 29372-1-AP

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 29372-1-AP (SLC6A19 antibody) at dilution of 1:200 (under 10x lens).

SLC6A19 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 29372-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

B0AT1, HND, Sodium-dependent neutral amino acid transporter B(0)AT1

---

Tested Applications

• Positive WB detected in: mouse kidney tissue, HeLa cells, rat kidney
• Positive IHC detected in: human kidney tissue, human small intestine tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IHC: See 1 publications below

Product Information

29372-1-AP targets SLC6A19 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31076

  Product name: Recombinant human SLC6A19 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 142-192 aa of BC148801

  Sequence: NSFQEPLPWSDCPLNENQTGYVDECARSSPVDYFWYRETLNISTSISDSGS

• Full Name: solute carrier family 6 (neutral amino acid transporter), member 19
• Calculated Molecular Weight: 634 aa, 71 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC148801
• Gene Symbol: SLC6A19
• Gene ID (NCBI): 340024
• RRID: AB_2918286
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q695T7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC6A19, also named as B0AT1, encodes system B(0) transmembrane protein that mediates epithelial resorption of neutral amino acids across the apical membrane in kidney and intestine (PubMed: 15044460). The protein contains 634 amino acids and has 12 predicted transmembrane regions with highly expression in human kidney and small intestine and minimal in pancreas (PubMed: 15286787). The expression of SLC6A19 in intestinal cells depends on angiotensin converting enzyme 2 which is the cellular receptor for SARS-CoV-2 (PubMed: 32132184). Mutations in SLC6A19 cause Hartnup disease (PMID: 15286787, PMID: 15286788).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	Am J Pathol; Role of Kir5.1 (Kcnj16) Channels in Regulating Renal Ammonia Metabolism during Metabolic Acidosis in Dahl Salt-Sensitive Rats; Authors - Biyang Xu
mouse	IHC	J Ethnopharmacol; Metabolomics and molecular docking-directed anti-obesity study of the ethanol extract from Gynostemma pentaphyllum (Thunb.) Makino; Authors - Suyun Xu