Product Information
20299-1-PBS targets SLC6A8 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14110 Product name: Recombinant human SLC6A8 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 541-635 aa of BC012355 Sequence: YYEPLVYNNTYVYPWWGEAMGWAFALSSMLCVPLHLLGCLLRAKGTMAERWQHLTQPIWGLHHLEYRAQDADVRGLTTLTPVSESSKVVVVESVM Predict reactive species |
| Full Name | solute carrier family 6 (neurotransmitter transporter, creatine), member 8 |
| Calculated Molecular Weight | 635 aa, 71 kDa |
| Observed Molecular Weight | 65-70 kDa |
| GenBank Accession Number | BC012355 |
| Gene Symbol | SLC6A8 |
| Gene ID (NCBI) | 6535 |
| RRID | AB_2878665 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P48029 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
SLC6A8, also known as the sodium- and chloride-dependent creatine transporter 1 (CT1), plays a critical role in transporting creatine, a crucial molecule for energy metabolism, into cells. SLC6A8 belongs to the solute carrier family 6 (SLC6), responsible for transporting diverse molecules across cell membranes. SLC6A8 expression is highest in muscle, kidney, and other tissues with high energy demands. Mutations in SLC6A8 cause creatine transporter deficiency, an X-linked mental retardation disorder (PMID: 17465020).













