SLC7A11/xCT Recombinant monoclonal antibody, PBS Only (Capture)

• 

  WB analysis of mouse brain using 82115-3-RR (same clone as 82115-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 82115-3-RR (SLC7A11 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82115-3-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 82115-3-RR (same clone as 82115-3-PBS)

  unboiled HeLa cells were subjected to SDS PAGE followed by western blot with 82115-3-RR (SLC7A11/xCT antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82115-3-PBS in a different storage buffer formulation.

• 

  Sandwich ELISA sample test of MP03119-1

  The mean SLC7A11/xCT concentration was determined to be 12.6 ng/mL in HepG2 cell extract based on a 1.2 mg/mL extract load and 1.9 ng/mL in SW480 cell extract based on a 3.0 mg/mL extract load.

• 

  Sandwich ELISA standard curve of MP03119-1

  Sandwich ELISA standard curve of MP03119-1, Human SLC7A11/xCT Recombinant Matched Antibody Pair - PBS only. 82115-3-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag25431. 82115-4-PBS was HRP conjugated as the detection antibody. Range: 195-6250 pg/mL.

• 

  IF Staining of HepG2 using 82115-3-RR (same clone as 82115-3-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HepG2 cells using SLC7A11/xCT antibody (82115-3-RR, Clone: 252789G7 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 82115-3-PBS in a different storage buffer formulation.

SLC7A11/xCT Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Sandwich ELISA, Indirect ELISA

Cat No. 82115-3-PBS

Clone No.252789G7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, Sandwich ELISA, Indirect ELISA

Synonyms

SLC7A11, xCT, Amino acid transport system xc, Amino acid transport system xc-, CCBR1

---

Product Information

82115-3-PBS targets SLC7A11/xCT as part of a matched antibody pair:

MP03119-1: 82115-3-PBS capture and 82115-4-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag25431

  Product name: Recombinant human SLC7A11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-42 aa of BC012087

  Sequence: MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKR

• Full Name: solute carrier family 7, (cationic amino acid transporter, y+ system) member 11
• Calculated Molecular Weight: 55 kDa
• Observed Molecular Weight: 35-40 kDa
• GenBank Accession Number: BC012087
• Gene Symbol: SLC7A11
• Gene ID (NCBI): 23657
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UPY5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SLC7A11 (also known as xCT) is a membrane transporter involved in the uptake of cystine. It promotes glutathione synthesis through the uptake of cystine and the concomitant release of glutamate. This, in turn, protects cells from oxidative stress, maintains cellular redox balance, and prevents cell death induced by lipid peroxidation. SLC7A11 has been identified as a potential target for cancer therapeutics. It is overexpressed in multiple malignant tumors and is closely associated with the growth, prognosis, metastasis, and treatment response of various cancers including lung cancer. The SLC7A11 protein appears at two molecular weights, 55 kDa and 35 kDa, and the 55 kDa protein is ubiquitinated(PMID: 32188872). 82115-3-RR recognizes the 35-40 kDa protein similar to the paper published (PMID: 36747082).