SLC7A11/xCT Recombinant monoclonal antibody

SLC7A11/xCT Uni-rAb® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 82115-3-RR
Clone No.252789G7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, ELISA

SLC7A11, xCT, Amino acid transport system xc, Amino acid transport system xc-, CCBR1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inunboiled HeLa cells, unboiled mouse brain tissue
Positive IF/ICC detected inHepG2 cells

For optimal WB detection with 82115-3-RR, we do not recommend boiling the sample after lysis.

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

82115-3-RR targets SLC7A11/xCT in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag25431

Product name: Recombinant human SLC7A11 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-42 aa of BC012087

Sequence: MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKR

Predict reactive species
Full Name solute carrier family 7, (cationic amino acid transporter, y+ system) member 11
Calculated Molecular Weight 55 kDa
Observed Molecular Weight 35-40 kDa
GenBank Accession NumberBC012087
Gene Symbol SLC7A11
Gene ID (NCBI) 23657
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9UPY5
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC7A11 (also known as xCT) is a membrane transporter involved in the uptake of cystine. It promotes glutathione synthesis through the uptake of cystine and the concomitant release of glutamate. This, in turn, protects cells from oxidative stress, maintains cellular redox balance, and prevents cell death induced by lipid peroxidation. SLC7A11 has been identified as a potential target for cancer therapeutics. It is overexpressed in multiple malignant tumors and is closely associated with the growth, prognosis, metastasis, and treatment response of various cancers including lung cancer. The SLC7A11 protein appears at two molecular weights, 55 kDa and 35 kDa, and the 55 kDa protein is ubiquitinated(PMID: 32188872). 82115-3-RR recognizes the 35-40 kDa protein similar to the paper published (PMID: 36747082).

Protocols

Product Specific Protocols
IF protocol for SLC7A11/xCT antibody 82115-3-RRDownload protocol
WB protocol for SLC7A11/xCT antibody 82115-3-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...