Tested Applications
Positive WB detected in | HEK-293 cells, mouse testis tissue, mouse colon tissue, mouse liver tissue, mouse kidney tissue |
Positive IHC detected in | human kidney tissue, human colon tissue, human lung tissue, human ovary tissue, human placenta tissue, human skin tissue, human testis tissue, mouse testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HEK-293 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
IF | See 1 publications below |
Product Information
18318-1-AP targets NHE8 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag13111 Product name: Recombinant human NHE8 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 471-581 aa of BC112213 Sequence: IRLMDIEDAKAHRRNKKDVNLSKTEKMGNTVESEHLSELTEEEYEAHYIRRQDLKGFVWLDAKYLNPFFTRRLTQEDLHHGRIQMKTLTNKWYEEVRQGPSGSEDDEQELL Predict reactive species |
Full Name | solute carrier family 9 (sodium/hydrogen exchanger), member 8 |
Calculated Molecular Weight | 581 aa, 65 kDa |
Observed Molecular Weight | 70-85 kDa |
GenBank Accession Number | BC112213 |
Gene Symbol | SLC9A8 |
Gene ID (NCBI) | 23315 |
RRID | AB_2270442 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9Y2E8 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NHE8, encoded by SLC9A8, is a member of sodium/hydrogen exchanger family which are transmembrane proteins that mediate the electroneutral exchange of sodium (Na) for hydrogen (H) and get involved in intracellular pH homeostasis, cell volume regulation, acid-base regulation, and so on. NHE8 has a broad tissue distribution, with relatively high abundance in the gastrointestinal tract. It has been reported that NHE8 expression differs among different regions in the stomach, very low in nonglandular region whereas very high in glandular region. The predicted molecular weight of NHE8 is 64-65 kDa, while its glycosylated form often migrates around 70-85 kDa.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for NHE8 antibody 18318-1-AP | Download protocol |
IHC protocol for NHE8 antibody 18318-1-AP | Download protocol |
IF protocol for NHE8 antibody 18318-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |