Tested Applications
| Positive WB detected in | HepG2 cells, COLO 320 cells, HeLa cells, Jurkat cells, K-562 cells, HSC-T6 cells, 4T1 cells |
| Positive IP detected in | HeLa cells |
| Positive IF/ICC detected in | HepG2 cells, PC-3 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66561-1-Ig targets SMARCA4/BRG1 in WB, IF/ICC, IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16256 Product name: Recombinant human SMARCA4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 207-298 aa of BC150298 Sequence: KRPMPGMQQQMPTLPPPSVSATGPGPGPGPGPGPGPGPAPPNYSRPHGMGGPNMPPPGPSGVPPGMPGQPPGGPPKPWPEGPMANAAAPTST Predict reactive species |
| Full Name | SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 |
| Calculated Molecular Weight | 1647 aa, 185 kDa |
| Observed Molecular Weight | 185 kDa |
| GenBank Accession Number | BC150298 |
| Gene Symbol | SMARCA4 |
| Gene ID (NCBI) | 6597 |
| RRID | AB_2881922 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P51532 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SMARCA4, also named as BAF190A, BRG1, SNF2B and SNF2L4, belongs to the SNF2/RAD54 helicase family. SMARCA4 is a transcriptional coactivator cooperating with nuclear hormone receptors to potentiate transcriptional activation. It is a component of the CREST-BRG1 complex, a multiprotein complex that regulates promoter activation by orchestrating a calcium-dependent release of a repressor complex and a recruitment of an activator complex. It is also involved in vitamin D-coupled transcription regulation via its association with the WINAC complex, a chromatin-remodeling complex recruited by vitamin D receptor (VDR), which is required for the ligand-bound VDR-mediated transrepression of the CYP27B1 gene.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SMARCA4/BRG1 antibody 66561-1-Ig | Download protocol |
| IP protocol for SMARCA4/BRG1 antibody 66561-1-Ig | Download protocol |
| WB protocol for SMARCA4/BRG1 antibody 66561-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-BRG1 (Cat# 66561-1-Ig) has 5 citations published in J Clin Invest, Advanced Science, Cell Reports Medicine, Frontiers in Pharmacology, and Inflammation. Research fields include triple-negative breast cancer, diabetic foot ulcer wound healing, NSCLC immunotherapy, cardiac TRPM4 channel regulation, and chronic rhinosinusitis with nasal polyps. Applications span IF, WB, and ChIP across human, mouse, and rat species.
| Species | Application | Title |
|---|---|---|
J Clin Invest Targeting kinesin family member 20A sensitizes stem-like triple-negative breast cancer cells to standard chemotherapy. | ||
Cell Rep Med Dual PD-1/IL-2Rα targeting restores CD8(+) T cell fitness via STAT5/CD47 axis in SMARCA4-deficient NSCLC.
| ||
Inflammation Regulation of KDM2B and Brg1 on Inflammatory Response of Nasal Mucosa in CRSwNP.
| ||
Front Pharmacol Brg1 and RUNX1 synergy in regulating TRPM4 channel in mouse cardiomyocytes |
