SMARCA4/BRG1 Monoclonal antibody

• 

  WB analysis using 66561-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66561-1-Ig (SMARCA4/BRG1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 66561-1-Ig

  WB result of SMARCA4/BRG1 antibody (66561-1-Ig; 1:5000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SMARCA4/BRG1 transfected HepG2 cells.

• 

  WB analysis of COLO 320 using 66561-1-Ig

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 66561-1-Ig (SMARCA4/BRG1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 66561-1-Ig

  IP result of anti-SMARCA4/BRG1 (IP:66561-1-Ig, 5ug; Detection:66561-1-Ig 1:3000) with HeLa cells lysate 3200 ug.

• 

  IF Staining of HepG2 using 66561-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using SMARCA4/BRG1 antibody (66561-1-Ig, Clone: 2E6B6 ) at dilution of 1:50000 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red).

• 

  IF Staining of PC-3 using 66561-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed PC-3 cells using SMARCA4/BRG1 antibody (66561-1-Ig, Clone: 2E6B6 ) at dilution of 1:50000 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red).

• 

  IF Staining of HepG2 using 66561-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using SMARCA4/BRG1 antibody (66561-1-Ig, Clone: 2E6B6 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red).

• Featured Product
• KD/KO Validated

SMARCA4/BRG1 Monoclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 66561-1-Ig

Clone No.2E6B6

Publications(2)

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, IP, ChIP, ELISA

Synonyms

SMARCA4, 2E6B6, ATP dependent helicase SMARCA4, ATP-dependent helicase SMARCA4, BAF190

---

Tested Applications

• Positive WB detected in: HepG2 cells, COLO 320 cells, HeLa cells, Jurkat cells, K-562 cells, HSC-T6 cells, 4T1 cells
• Positive IP detected in: HeLa cells
• Positive IF/ICC detected in: HepG2 cells, PC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below
• IF: See 1 publications below
• ChIP: See 1 publications below

Product Information

66561-1-Ig targets SMARCA4/BRG1 in WB, IF/ICC, IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16256

  Product name: Recombinant human SMARCA4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 207-298 aa of BC150298

  Sequence: KRPMPGMQQQMPTLPPPSVSATGPGPGPGPGPGPGPGPAPPNYSRPHGMGGPNMPPPGPSGVPPGMPGQPPGGPPKPWPEGPMANAAAPTST

• Full Name: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4
• Calculated Molecular Weight: 1647 aa, 185 kDa
• Observed Molecular Weight: 185 kDa
• GenBank Accession Number: BC150298
• Gene Symbol: SMARCA4
• Gene ID (NCBI): 6597
• RRID: AB_2881922
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P51532
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SMARCA4, also named as BAF190A, BRG1, SNF2B and SNF2L4, belongs to the SNF2/RAD54 helicase family. SMARCA4 is a transcriptional coactivator cooperating with nuclear hormone receptors to potentiate transcriptional activation. It is a component of the CREST-BRG1 complex, a multiprotein complex that regulates promoter activation by orchestrating a calcium-dependent release of a repressor complex and a recruitment of an activator complex. It is also involved in vitamin D-coupled transcription regulation via its association with the WINAC complex, a chromatin-remodeling complex recruited by vitamin D receptor (VDR), which is required for the ligand-bound VDR-mediated transrepression of the CYP27B1 gene.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	Inflammation; Regulation of KDM2B and Brg1 on Inflammatory Response of Nasal Mucosa in CRSwNP.; Authors - C C Liu ; KD Validated
mouse	ChIP	Front Pharmacol; Brg1 and RUNX1 synergy in regulating TRPM4 channel in mouse cardiomyocytes; Authors - Tao Ban