SMARCA4/BRG1 Monoclonal antibody, PBS Only

• 

  WB analysis of HepG2 using 66561-1-Ig (same clone as 66561-1-PBS)

  WB result of SMARCA4/BRG1 antibody (66561-1-Ig; 1:5000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SMARCA4/BRG1 transfected HepG2 cells. This data was developed using the same antibody clone with 66561-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66561-1-Ig (same clone as 66561-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66561-1-Ig (SMARCA4/BRG1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66561-1-PBS in a different storage buffer formulation.

• 

  WB analysis of COLO 320 using 66561-1-Ig (same clone as 66561-1-PBS)

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 66561-1-Ig (SMARCA4/BRG1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66561-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 66561-1-Ig (same clone as 66561-1-PBS)

  IP result of anti-SMARCA4/BRG1 (IP:66561-1-Ig, 5ug; Detection:66561-1-Ig 1:3000) with HeLa cells lysate 3200 ug. This data was developed using the same antibody clone with 66561-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 66561-1-Ig (same clone as 66561-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using SMARCA4/BRG1 antibody (66561-1-Ig, Clone: 2E6B6 ) at dilution of 1:50000 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 66561-1-PBS in a different storage buffer formulation.

• 

  IF Staining of PC-3 using 66561-1-Ig (same clone as 66561-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed PC-3 cells using SMARCA4/BRG1 antibody (66561-1-Ig, Clone: 2E6B6 ) at dilution of 1:50000 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 66561-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 66561-1-Ig (same clone as 66561-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using SMARCA4/BRG1 antibody (66561-1-Ig, Clone: 2E6B6 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 66561-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

SMARCA4/BRG1 Monoclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 66561-1-PBS

Clone No.2E6B6

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, IP, ELISA

Synonyms

SMARCA4, 2E6B6, ATP dependent helicase SMARCA4, ATP-dependent helicase SMARCA4, BAF190

---

Product Information

66561-1-PBS targets SMARCA4/BRG1 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16256

  Product name: Recombinant human SMARCA4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 207-298 aa of BC150298

  Sequence: KRPMPGMQQQMPTLPPPSVSATGPGPGPGPGPGPGPGPAPPNYSRPHGMGGPNMPPPGPSGVPPGMPGQPPGGPPKPWPEGPMANAAAPTST

• Full Name: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4
• Calculated Molecular Weight: 1647 aa, 185 kDa
• Observed Molecular Weight: 185 kDa
• GenBank Accession Number: BC150298
• Gene Symbol: SMARCA4
• Gene ID (NCBI): 6597
• RRID: AB_2881922
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P51532
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SMARCA4, also named as BAF190A, BRG1, SNF2B and SNF2L4, belongs to the SNF2/RAD54 helicase family. SMARCA4 is a transcriptional coactivator cooperating with nuclear hormone receptors to potentiate transcriptional activation. It is a component of the CREST-BRG1 complex, a multiprotein complex that regulates promoter activation by orchestrating a calcium-dependent release of a repressor complex and a recruitment of an activator complex. It is also involved in vitamin D-coupled transcription regulation via its association with the WINAC complex, a chromatin-remodeling complex recruited by vitamin D receptor (VDR), which is required for the ligand-bound VDR-mediated transrepression of the CYP27B1 gene.