Tested Applications
| Positive WB detected in | HepG2 cells, COLO 320 cells, HeLa cells, Jurkat cells, K-562 cells, HSC-T6 cells, 4T1 cells |
| Positive IP detected in | HeLa cells |
| Positive IF/ICC detected in | HepG2 cells, PC-3 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 1 publications below |
| IF | See 1 publications below |
| ChIP | See 1 publications below |
Product Information
66561-1-Ig targets SMARCA4/BRG1 in WB, IF/ICC, IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16256 Product name: Recombinant human SMARCA4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 207-298 aa of BC150298 Sequence: KRPMPGMQQQMPTLPPPSVSATGPGPGPGPGPGPGPGPAPPNYSRPHGMGGPNMPPPGPSGVPPGMPGQPPGGPPKPWPEGPMANAAAPTST Predict reactive species |
| Full Name | SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 |
| Calculated Molecular Weight | 1647 aa, 185 kDa |
| Observed Molecular Weight | 185 kDa |
| GenBank Accession Number | BC150298 |
| Gene Symbol | SMARCA4 |
| Gene ID (NCBI) | 6597 |
| RRID | AB_2881922 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P51532 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SMARCA4, also named as BAF190A, BRG1, SNF2B and SNF2L4, belongs to the SNF2/RAD54 helicase family. SMARCA4 is a transcriptional coactivator cooperating with nuclear hormone receptors to potentiate transcriptional activation. It is a component of the CREST-BRG1 complex, a multiprotein complex that regulates promoter activation by orchestrating a calcium-dependent release of a repressor complex and a recruitment of an activator complex. It is also involved in vitamin D-coupled transcription regulation via its association with the WINAC complex, a chromatin-remodeling complex recruited by vitamin D receptor (VDR), which is required for the ligand-bound VDR-mediated transrepression of the CYP27B1 gene.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SMARCA4/BRG1 antibody 66561-1-Ig | Download protocol |
| IP protocol for SMARCA4/BRG1 antibody 66561-1-Ig | Download protocol |
| WB protocol for SMARCA4/BRG1 antibody 66561-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Front Pharmacol Brg1 and RUNX1 synergy in regulating TRPM4 channel in mouse cardiomyocytes | ||
Inflammation Regulation of KDM2B and Brg1 on Inflammatory Response of Nasal Mucosa in CRSwNP.
|













