SMARCA4/BRG1 Recombinant monoclonal antibody

SMARCA4/BRG1 Uni-rAb® Recombinant Antibody for WB, IHC, FC (Intra), ELISA

Cat No. 83310-7-RR
Clone No.240172F7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, FC (Intra), ELISA

SMARCA4, 240172F7, ATP dependent helicase SMARCA4, ATP-dependent helicase SMARCA4, BAF190

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HepG2 cells, HSC-T6 cells, NIH/3T3 cells, HEK-293T cells, C6 cells
Positive IHC detected inhuman tonsillitis tissue, human colon cancer tissue, mouse kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inJurkat cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83310-7-RR targets SMARCA4/BRG1 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag16256

Product name: Recombinant human SMARCA4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 207-298 aa of BC150298

Sequence: KRPMPGMQQQMPTLPPPSVSATGPGPGPGPGPGPGPGPAPPNYSRPHGMGGPNMPPPGPSGVPPGMPGQPPGGPPKPWPEGPMANAAAPTST

Predict reactive species
Full Name SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4
Calculated Molecular Weight 1647 aa, 185 kDa
Observed Molecular Weight 185 kDa
GenBank Accession NumberBC150298
Gene Symbol SMARCA4
Gene ID (NCBI) 6597
RRIDAB_3670977
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP51532
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SMARCA4, also named as BAF190A, BRG1, SNF2B and SNF2L4, belongs to the SNF2/RAD54 helicase family. SMARCA4 is a transcriptional coactivator cooperating with nuclear hormone receptors to potentiate transcriptional activation. It is a component of the CREST-BRG1 complex, a multiprotein complex that regulates promoter activation by orchestrating a calcium-dependent release of a repressor complex and a recruitment of an activator complex. It is also involved in vitamin D-coupled transcription regulation via its association with the WINAC complex, a chromatin-remodeling complex recruited by vitamin D receptor (VDR), which is required for the ligand-bound VDR-mediated transrepression of the CYP27B1 gene.

Protocols

Product Specific Protocols
FC protocol for SMARCA4/BRG1 antibody 83310-7-RRDownload protocol
IHC protocol for SMARCA4/BRG1 antibody 83310-7-RRDownload protocol
WB protocol for SMARCA4/BRG1 antibody 83310-7-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...