SMARCA4/BRG1 Recombinant monoclonal antibody, PBS Only

SMARCA4/BRG1 Uni-rAb® Recombinant Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 83310-7-PBS
Clone No.240172F7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, FC (Intra), ELISA

SMARCA4, 240172F7, ATP dependent helicase SMARCA4, ATP-dependent helicase SMARCA4, BAF190

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83310-7-PBS targets SMARCA4/BRG1 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag16256

Product name: Recombinant human SMARCA4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 207-298 aa of BC150298

Sequence: KRPMPGMQQQMPTLPPPSVSATGPGPGPGPGPGPGPGPAPPNYSRPHGMGGPNMPPPGPSGVPPGMPGQPPGGPPKPWPEGPMANAAAPTST

Predict reactive species
Full Name SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4
Calculated Molecular Weight 1647 aa, 185 kDa
Observed Molecular Weight 185 kDa
GenBank Accession NumberBC150298
Gene Symbol SMARCA4
Gene ID (NCBI) 6597
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP51532
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

SMARCA4, also named as BAF190A, BRG1, SNF2B and SNF2L4, belongs to the SNF2/RAD54 helicase family. SMARCA4 is a transcriptional coactivator cooperating with nuclear hormone receptors to potentiate transcriptional activation. It is a component of the CREST-BRG1 complex, a multiprotein complex that regulates promoter activation by orchestrating a calcium-dependent release of a repressor complex and a recruitment of an activator complex. It is also involved in vitamin D-coupled transcription regulation via its association with the WINAC complex, a chromatin-remodeling complex recruited by vitamin D receptor (VDR), which is required for the ligand-bound VDR-mediated transrepression of the CYP27B1 gene.

Loading...
||
New chat

Able

正在加载,请稍候...