SMIM1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SMIM1 Polyclonal antibody (27849-1-AP)

SMIM1 Polyclonal Antibody for WB, ELISA

Cat No. 27849-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

Human, Mouse and More (1)

Applications

WB, ELISA

Synonyms

hypothetical LOC388588, LOC388588, Small integral membrane protein 1, SMIM1

• 

  WB analysis of HEK-293 using 27849-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 27849-1-AP (SMIM1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 27849-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27849-1-AP (SMIM1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse kidney using 27849-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 27849-1-AP (SMIM1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SMIM1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, mouse kidney tissue, mouse testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27849-1-AP targets SMIM1 in WB, ELISA applications and shows reactivity with Human, Mouse samples.

• Tested Reactivity: Human, Mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27028

  Product name: Recombinant human LOC388588 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-78 aa of BC146957

  Sequence: MQPQESHVHYSRWEDGSRDGVSLGAVSSTEEASRCRRISQRLCTGKLGIAMKVLGGVALFWIIFILGYLTGYYVHKCK

• Full Name: hypothetical LOC388588
• Observed Molecular Weight: 9 kDa
• GenBank Accession Number: BC146957
• Gene Symbol: SMIM1
• Gene ID (NCBI): 388588
• RRID: AB_2880993
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: B2RUZ4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Small integral membrane protein 1(SMIM1) is a type II transmembrane phosphoprotein and displays the Vel blood group antigen at its carboxyl-terminus. SMIM1 is highly expressed in hematopoietic cells. It is associated with a variety of immune responses and plays an important role in RBC differentiation. SMIM1 can be used as a potential biomarker for the diagnosis of IDD (PMID: 30906890; 26452714).

Publications

What published studies show

The SMIM1 Polyclonal antibody (Cat# 27849-1-AP) has 1 citation to date. It was cited in Transfus Med Hemother (2023), a study on CRISPR/Cas9-mediated knockout of the Vel antigen gene in K562 cells for transfusion applications. The research falls within the fields of transfusion medicine, blood group serology, and gene editing. The antibody was used for Western blot validation in human samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Transfus Med Hemother; CRISPR/Cas9-Editing K562 Cell Line as a Potential Tool in Transfusion Applications: Knockout of Vel Antigen Gene; Authors - Jiaxuan Yang ; KO Validated