Tested Applications
| Positive WB detected in | HEK-293 cells, mouse kidney tissue, mouse testis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 1 publications below |
Product Information
27849-1-AP targets SMIM1 in WB, ELISA applications and shows reactivity with Human, Mouse samples.
| Tested Reactivity | Human, Mouse |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag27028 Product name: Recombinant human LOC388588 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-78 aa of BC146957 Sequence: MQPQESHVHYSRWEDGSRDGVSLGAVSSTEEASRCRRISQRLCTGKLGIAMKVLGGVALFWIIFILGYLTGYYVHKCK Predict reactive species |
| Full Name | hypothetical LOC388588 |
| Observed Molecular Weight | 9 kDa |
| GenBank Accession Number | BC146957 |
| Gene Symbol | SMIM1 |
| Gene ID (NCBI) | 388588 |
| RRID | AB_2880993 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | B2RUZ4 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Small integral membrane protein 1(SMIM1) is a type II transmembrane phosphoprotein and displays the Vel blood group antigen at its carboxyl-terminus. SMIM1 is highly expressed in hematopoietic cells. It is associated with a variety of immune responses and plays an important role in RBC differentiation. SMIM1 can be used as a potential biomarker for the diagnosis of IDD (PMID: 30906890; 26452714).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for SMIM1 antibody 27849-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





