SMR3B Recombinant monoclonal antibody

• 

  WB analysis of human saliva using 85745-3-RR

  human saliva were subjected to SDS PAGE followed by western blot with 85745-3-RR (SMR3B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  Affinity of 85745-3-RR

  Biolayer interferometry (BLl) kinetic assays of 85745-3-RR against Human SMR3B were performed. The affinity constant is 0.785 nM.

SMR3B Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 85745-3-RR

Clone No.242868D3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

P B, PBII, PRL3, PROL3, Proline rich peptide P B

---

Tested Applications

• Positive WB detected in: human saliva, human saliva tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

85745-3-RR targets SMR3B in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3081

  Product name: Recombinant Human SMR3B protein (rFc Tag) (HPLC verified)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 23-79 aa of NM_006685.4

  Sequence: QRGPRGPYPPGPLAPPQPFGPGFVPPPPPPPYGPGRIPPPPPAPYGPGIFPPPPPQP

• Full Name: submaxillary gland androgen regulated protein 3B
• Calculated Molecular Weight: 8 kDa
• Observed Molecular Weight: 8 kDa
• GenBank Accession Number: NM_006685.4
• Gene Symbol: SMR3B
• Gene ID (NCBI): 10879
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P02814
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SMR3B is an androgen-regulated secreted PRP-family peptide produced primarily in the submandibular and sublingual glands. Released into saliva, it contributes to lubrication, oral defense, and glandular homeostasis. Highly tissue-specific, SMR3B serves as a marker of salivary gland function and is altered in xerostomia, Sjögren's syndrome, and head-and-neck cancers, highlighting its relevance in secretory physiology and disease.