SNAPIN Recombinant monoclonal antibody

• 

  WB analysis using 85949-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 85949-1-RR (SNAPIN antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  Affinity and Kinetic Characterization of 85949-1-RR

  Biolayer interferometry (BLl) kinetic assays of 85949-1-RR against Human SNAPIN were performed. The affinity constant is 7.37 nM.

SNAPIN Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 85949-1-RR

Clone No.250300F4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Biogenesis of lysosome-related organelles complex 1 subunit 7, BLOC-1 subunit 7, BLOC1S7, SNAP associated protein, SNAP25BP

---

Tested Applications

• Positive WB detected in: HEK-293 cells, A375 cells, SKOV-3 cells, DU 145 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

85949-1-RR targets SNAPIN in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0101

  Product name: Recombinant human SNAPIN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-136 aa of BC000761

  Sequence: MAGAGSAAVSGAGTPVAGPTGRDLFAEGLLEFLRPAVQQLDSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGIYPPGSPGK

• Full Name: SNAP-associated protein
• Calculated Molecular Weight: 15 kDa
• Observed Molecular Weight: 15-18 kDa
• GenBank Accession Number: BC000761
• Gene Symbol: SNAPIN
• Gene ID (NCBI): 23557
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O95295
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Snapin, a protein of relative molecular weight of 15kd, is implicated in neurotransmission by binding to SNAP-25. Snapin was enriched in neurons and exclusively located on synaptic vesicle membrane, which may be a PKA target for modulating transmitter release through the cAMP-dependent signal-transduction pathway. This anitbody can recognize the 15-18kd(Monomer) and 30-36kd(Dimer) forms of SNAPIN.